(data stored in ACNUC7421 zone)

EMBL: CP001630.PE201

CP001630.PE201       Location/Qualifiers
FT   CDS_pept        218756..219226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34175"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34175.1"
FT                   /translation="MLLIAVDGPSGSGKTTYARSLGGVVVPTDHFATWDDPVAWWPRLV
FT                   EGVLEPLWRDEPAHYQRVEWVGGEPKPGEWITFEPPEVLVLEGVSSARRAIADRLDLAV
FT                   WVEVPSESERLERAVARDGEDCRIHLRRWQDFERGWFAVDGTKARADRVILR"
     gtgctcctga tcgccgtcga cgggccgtcg ggctcgggca agaccaccta cgcccgctcg        60
     ctcggcggcg tggtggtgcc gacggaccac ttcgccacct gggacgaccc ggtggcgtgg       120
     tggccgaggt tggtggaggg cgtgctcgaa ccgctctggc gcgacgagcc cgcccactac       180
     cagcgcgtcg agtgggtcgg cggcgagccg aagccggggg agtggatcac cttcgagccg       240
     ccggaggtcc tggtgctgga gggcgtgtcc tccgcgcgca gggcgatcgc ggaccggttg       300
     gacctcgcgg tgtgggtgga ggtgccgtcg gagtccgagc gcctggagcg cgcggtcgcg       360
     cgggacggcg aggactgccg gatccacctc cgccggtggc aggacttcga gcgcgggtgg       420
     ttcgcggtgg acggcacgaa ggcccgcgcg gaccgggtga tcctccgcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page