(data stored in ACNUC7421 zone)

EMBL: CP001630.PE202

CP001630.PE202       Location/Qualifiers
FT   CDS_pept        complement(225081..228347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0205"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; TPR repeat-
FT                   containing protein; Tetratricopeptide TPR_4; NB-ARC domain
FT                   protein; transcriptional regulator domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34176"
FT                   /db_xref="GOA:C6WF44"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF44"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34176.1"
FT                   /translation="MGEQLELGVLGPLRVVVGGRHVAVRAGRQRCLLASLLTRPGSPVS
FT                   VDELAEHVWGDRPPARARQTLHTYVMRLRRLLGPEVPIRTVPDGYLVDVPAASVDVARF
FT                   DGLLALGDREQAAGRLAEASSALAAALELWRGPALADVPSAVLHRDEAPRLTECGLHAR
FT                   ERRAEVDLALGRHAELVPELTALTAEHPLRERLWAQLVVALHRSGRRAEALAAYDRVSA
FT                   LLAEELGIDPGGELRRVHRAVLADEGGPAPGPEGAESGPEPVAPSQLPAGAGDFVGRSN
FT                   SVHLVETLLRRSHGVPVVTLSGQPGVGKTALAVHAAHRLRGDFPDGQLYVNLRGHAQGP
FT                   PLSAVDVLPRFLRAQGVAPESVPLDPDEQEALYRSRLTGRRVLVVLDDAASAEQIRPLL
FT                   PGSPGCAVLVTSRDALRGLAVSHAATNVRLDVLDDGEARALLSGVLGADVVGCQRAATG
FT                   ELVALCAHLPLALRIAAANVLSRPGTTVAEHVEELRAGNRLAALSVEGDERAAVQAAFD
FT                   LSYAALKPELAQLFRLLAVAPGDLTPDLAAALGGLPVPEARRRLHRLATVNLVDRPAPG
FT                   RYQFHDLLRDYAAQRLVAEDGEAGRDRVFRRLLDWSIRSVDAATEALKSTLVRHPRASD
FT                   VPGVEPKRFDSPAEALAWLDAERANLVALVSHAAARPPHEDGWQLADALRRYFYLAALP
FT                   VEWRAAAGAGLASARAARDPVGEAAMLSSLGVLYWSIGRHPVAVDHFLSALGVQERGGA
FT                   WPRARAQVLANLGAVYIDVGELERATEHLERALAITGEIGALQQQGITQLNLGGVYLQL
FT                   AELDRAAACFEGALDVGTRLGVWMTQADALHALAEVELLRGAPARAAGLFERSGELYGL
FT                   AGARSFAHIPHEGLAQAHLARGRYAEAIAEAGRALEFAQERENLKGRCDAKNVLGQALV
FT                   GAGRLVEGAGRHTEALGIAEEISYPWGIVAARRGLATAHHAAGRLVEAEEAARGALEGA
FT                   AAYRLRLPEGDVLVLLGRIELDLGEPDRALDTATRAAAAGAASGRRLLAAQADHLLGDL
FT                   RAAAGDSRAARALWDAAAAGYESAGAPEATSLRTLLRRVS"
     gtgggcgagc agctcgagct gggcgtcctc ggaccgctgc gggtggtggt cggcgggcgg        60
     cacgtcgcgg tgcgcgcggg caggcagcgg tgcctgctgg cgtccctgct gacgcggccg       120
     ggatcgccgg tctcggtgga cgagctggcc gagcacgtgt ggggcgaccg gccgcccgcg       180
     cgggccaggc agaccctgca cacctacgtc atgcggctgc gcaggctcct cggcccggag       240
     gtgccgatcc ggaccgtccc ggacggctac ctggtggacg tcccggccgc ctccgtggac       300
     gtcgccaggt tcgacgggct gctcgcgctc ggcgaccgcg agcaggccgc cggacggctc       360
     gccgaggcct cgtccgcgct ggcagcggcc ttggagctgt ggcggggacc ggcgctggcg       420
     gacgtcccgt cggcggtgct gcaccgcgac gaggcgcccc ggctgaccga gtgcgggctg       480
     cacgcgcgag agcgccgagc ggaggtcgac ctggcgctcg ggcggcacgc cgaactggtg       540
     ccggagctga ccgcgctgac cgccgagcac cccctgcggg agcgcctgtg ggcgcagctc       600
     gtggtggccc tgcaccgctc gggaaggcgg gccgaggcgc tggccgcgta cgaccgggtg       660
     agcgccctcc tggccgagga gctgggcatc gaccccggcg gggagctgcg ccgcgtgcac       720
     cgggccgtgc tggccgacga gggcggtccc gcccctggtc cggagggggc ggagagcggt       780
     ccggaaccgg tcgcgccgtc ccagctcccg gcgggcgccg gggacttcgt ggggcgctcg       840
     aactcggttc acctcgtgga aacactgctg cgcagatcac acggtgtgcc ggtcgtcacc       900
     ttgtccgggc aacccggagt aggtaaaacc gccctcgccg tgcacgccgc gcaccggttg       960
     cgcggggact tcccggacgg tcagctgtac gtgaacctgc gtggacacgc ccaggggccg      1020
     ccgctgagcg ccgtggacgt gctgccgagg ttcctgcgcg cccagggcgt cgcccccgag      1080
     tcggtgccgc tggacccgga cgagcaggag gccctctacc gctcccggct gaccggcagg      1140
     cgggtgctgg tggtgctgga cgacgcggcg agcgccgagc agatccgccc gctgctgccc      1200
     ggctcccccg gttgcgccgt cctggtgacc agccgggacg cgctgcgcgg cctggcggtc      1260
     agccacgcgg ccacgaacgt gcgcctggac gtgctcgacg acggcgaggc cagggcgctg      1320
     ctgtccgggg tgctcggcgc ggacgtggtc ggctgccagc gcgccgccac cggcgagctg      1380
     gtggccctgt gcgcccacct gccgctggcg ctgcggatcg ccgccgcgaa cgtgctgagc      1440
     agaccgggga ccaccgtcgc cgagcacgtg gaggagctgc gcgcgggcaa ccggctggcg      1500
     gcgctgagcg tggagggcga cgagcgggcc gccgtgcagg ccgcgttcga cctgtcgtac      1560
     gccgccctca agccggagct ggcgcagctg ttccggctgc tggcggtggc ccccggcgac      1620
     ctcaccccgg acctggcggc ggcgctgggc ggcctgcccg tcccggaggc ccgcaggcgc      1680
     ctgcaccggc tggccacggt gaacctggtc gaccggcccg cgccgggccg ctaccagttc      1740
     cacgacctgc tcagggacta cgcggcccag cgcctggtgg ccgaggacgg cgaggcgggc      1800
     cgggaccggg tgttccgcag gctgctggac tggtcgatcc gctcggtgga cgccgccacc      1860
     gaggcgctca agagcaccct ggtgcgccac cctcgcgcct cggacgtgcc gggagtggag      1920
     ccgaagcggt tcgactcgcc agccgaggcg ctggcctggt tggacgcgga gcgggcgaac      1980
     ctggtggcgc tggtgtccca cgccgccgcg cgcccgccgc acgaggacgg ctggcagttg      2040
     gcggacgcgc tgcgccgcta cttctacctg gcggcgctgc cggtggagtg gcgggcggcg      2100
     gcgggcgcgg gcctggcgtc ggcgcgggcc gcgcgggacc cggtgggcga ggcggcgatg      2160
     ctgtcgtcgc tgggggtcct gtactggtcg atcggcaggc acccggtggc cgtcgaccac      2220
     ttcctgtcgg ccctgggcgt gcaggagcgc ggcggggcgt ggccgagggc gcgggcgcag      2280
     gtcctggcga acctgggggc cgtgtacatc gacgtgggcg agctggagcg ggcgaccgag      2340
     cacctggagc gggcgctggc catcaccggg gagatcggcg cgctccagca gcagggcatc      2400
     acccagctga acctcggcgg cgtgtacctc cagctggccg agctggaccg ggccgcggcg      2460
     tgcttcgagg gcgcgctgga cgtcggcacg cgcctcgggg tgtggatgac ccaggcggac      2520
     gcgctgcacg cgctggccga ggtggagctg ctcaggggcg cgcccgcgcg ggcggcgggc      2580
     ctgttcgagc gctcgggcga gctgtacggg ctggccgggg cgcggagctt cgcgcacatc      2640
     ccgcacgagg ggctggcgca ggcgcacctg gcgcggggcc ggtacgcgga ggccatcgcg      2700
     gaggcgggcc gggcgctgga gttcgcgcag gagcgggaga acctgaaggg ccgctgcgac      2760
     gcgaagaacg tgctggggca ggccttggtg ggcgcggggc ggctcgtgga gggcgccggg      2820
     cggcacaccg aggcgctggg catcgccgag gagatcagct acccgtgggg catcgtggcc      2880
     gcccgcaggg gcctggcgac ggcgcaccac gcggcgggcc gcctggtgga ggccgaggag      2940
     gcggcgcggg gggccctgga gggcgcggcg gcctaccggc tgcggctgcc cgagggcgac      3000
     gtcctggtgc tgctgggccg gatcgagctg gacctcggcg agcctgaccg tgcgttggac      3060
     acggcgaccc gcgccgcggc ggcgggagcg gcctcgggga ggcgcctgct cgcggcccag      3120
     gccgaccacc tgctcgggga cctgagggcg gcagcgggcg attccagggc cgcacgggcc      3180
     ctctgggacg ccgctgcggc gggctacgag tccgcgggag ccccggaggc gacgtctctc      3240
     agaaccctcc tgcgccgcgt gtcctga                                          3267
//

If you have problems or comments...

PBIL Back to PBIL home page