(data stored in ACNUC7421 zone)

EMBL: CP001630.PE203

CP001630.PE203       Location/Qualifiers
FT   CDS_pept        228577..230262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0206"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hap:HAPS_0936 periplasmic dipeptide transport protein
FT                   DppA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34177"
FT                   /db_xref="GOA:C6WF45"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF45"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACU34177.1"
FT                   /translation="MVHSRSAQRRWVAAIGLTSAAALVLTSCVQSERSQDSGTGGAAGG
FT                   TFTFGAAGAPKLFDPMFATDGETFRVARQMFDGLTTFKPGTAEPAPSLAKEWSSTPDGL
FT                   TWTFKLETGVKFHDGSDFNAEAVCFNFDRWYNLKGDAQSDAVSQYYVDNFGGFSDKPET
FT                   SLYKSCAAEGADTAVVTLTKTTSKFPDILGLPSFSMQSPKALKEFNADDVKAQGDSFVF
FT                   PAYANEHPTGTGPFKFGKYDKANNVVELVRNDDYWGEKTKLDKLVFRIIPDETARKQAL
FT                   QSGDIDGFDFPNAADWDSLKSGGFNVEVRPAFNVFYVGINQKRNPKLQDLKVRQALLHA
FT                   INREQLVKSQLPEGAEVATQFIPKTVGGYADDVQKYEYSVDKAKSLLAEAGASDLTLKF
FT                   YWPSEVSRPYMPSPKDLYGAIAADLQAAGIKVEAVTKPWNGGYLTDVDQGAQADLFLLG
FT                   WTGDTGSADNWVGTFFGNPANRFNTGASAWGADLSAQLKTADAEPDRTKRYDLYKEINR
FT                   KIMAEYVPALPISHSPPALVVKNTVKGITPSPLTDEKFVDVTVN"
     atggttcatt cccgatcggc ccagcgacgc tgggtggctg cgatcggtct caccagtgcc        60
     gccgcgctcg tcctcacctc ctgcgtgcag tccgagcgca gccaggactc cgggaccggc       120
     ggcgccgcgg gcgggacgtt caccttcggg gccgcgggag ccccgaagct gttcgacccg       180
     atgttcgcga ccgacggtga gaccttccgc gtcgccaggc agatgttcga cggcctgacc       240
     acgttcaagc ccggcaccgc cgagcccgcg ccctcgctgg ccaaggagtg gtcgagcact       300
     cccgacggcc tcacgtggac gttcaagctc gagacgggcg tgaagttcca cgacggcagc       360
     gacttcaacg ccgaggccgt ctgcttcaac ttcgaccgct ggtacaacct gaagggcgac       420
     gcgcagtccg acgccgtctc ccagtactac gtcgacaact tcggcggctt ctccgacaag       480
     ccggagacgt cgctctacaa gagctgcgcc gccgagggcg ccgacaccgc cgtggtcacc       540
     ctgaccaaga cgacgtccaa gttcccggac atcctgggcc tgccgtcgtt ctccatgcag       600
     agcccgaagg ccctgaagga gttcaacgcc gacgacgtga aggcccaggg cgacagcttc       660
     gtcttcccgg cctacgcgaa cgagcacccg accggcacgg gcccgttcaa gttcggcaag       720
     tacgacaagg cgaacaacgt cgtcgagctc gtgcgcaacg acgactactg gggcgagaag       780
     accaagctgg acaagctggt cttccggatc atccccgacg agaccgcccg caagcaggcg       840
     ctgcagtccg gtgacatcga cggcttcgac ttcccgaacg ccgccgactg ggacagcctg       900
     aagagcggtg gcttcaacgt cgaggtccgc ccggcgttca acgtcttcta cgtgggcatc       960
     aaccagaagc ggaacccgaa gctccaggac ctcaaggtcc gccaggcgct gctgcacgcg      1020
     atcaaccgcg agcagctggt caagtcccag ctgcccgagg gcgccgaggt cgcgacgcag      1080
     ttcatcccga agaccgtggg cggctacgcc gacgacgtgc agaagtacga gtactcggtc      1140
     gacaaggcca agtcgctgct cgccgaggcg ggcgcgtccg acctgacgct gaagttctac      1200
     tggccctccg aggtcagccg cccgtacatg cccagcccga aggacctcta cggcgccatc      1260
     gccgcggacc tgcaggccgc gggcatcaag gtggaggcgg tcaccaagcc gtggaacggc      1320
     ggctacctga ccgacgtcga ccagggcgcg caggccgacc tgttcctgct cggctggacc      1380
     ggcgacaccg gtagcgcgga caactgggtg ggcaccttct tcggcaaccc ggccaaccgc      1440
     ttcaacaccg gggcctccgc gtggggcgcc gacctgtccg cgcagctgaa gacggctgac      1500
     gcggagccgg accggaccaa gcggtacgac ctctacaagg agatcaaccg caagatcatg      1560
     gccgagtacg tgccggcgct gccgatctcg cactcgccgc ccgcgctggt cgtgaagaac      1620
     accgtcaagg gcatcactcc gagcccgctg accgacgaga agttcgtcga cgtcacggtc      1680
     aactga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page