(data stored in ACNUC7421 zone)

EMBL: CP001630.PE204

CP001630.PE204       Location/Qualifiers
FT   CDS_pept        230308..231318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0207"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pde:Pden_1670
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34178"
FT                   /db_xref="GOA:C6WF46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF46"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34178.1"
FT                   /translation="MLRYTIRRLIQLVVVVLVLSLLVFSWLRALPGGPASALLGERGTE
FT                   ESRAALSKQLGLDQPIFVQYFKFLGRALTGDFGNSTGVQPGDAVVDIFLQRFPATIELS
FT                   AFAMLIAIALGIPLGYLAARKRGGLFDNLSVGGSLIGVAVPVFFLAYLLKYVFASQLGW
FT                   LPSAGRQSAGLDATRVTGFFVLDGFLTQEWDAALNALTHLVLPACALATIPFAVIFRIT
FT                   RAAVLDVLNEDYVRTAESKGLLGSVIRRRHILRNAMLPVVTTIGLQIGALLAGAVLTEK
FT                   VFAFPGVGEALAIGFERRDYPVLQMFILVAAMIYVLVNLLVDLSYALIDPRIRAR"
     gtgctccgct acaccatccg acggctgatc cagctcgtcg tcgtggtgct ggtgctctcg        60
     ttgctcgtct tctcgtggtt gcgcgcactc ccgggagggc cggcatcggc cctcctgggg       120
     gagcgcggca cggaagagtc acgggcggcg ttgagcaagc agctcggctt ggaccagccg       180
     atcttcgtcc agtacttcaa attcctgggc cgcgccctca ccggggactt cggcaactcg       240
     accggcgtgc agccgggtga cgcggtggtg gacatcttcc tccagcgctt ccccgccacg       300
     atcgagctga gcgccttcgc catgctgatc gcgatcgcgc tggggatccc cctgggctac       360
     ctggccgccc gcaagcgcgg cggcctgttc gacaacctga gcgtgggcgg ctcgctgatc       420
     ggcgtcgccg tgccggtctt cttcctggcc tacctgctca agtacgtctt cgcgtcgcag       480
     ctgggctggc tgccctccgc gggcaggcag tccgccggcc tcgacgcgac ccgcgtcacc       540
     ggcttcttcg tcctcgacgg cttcctcacg caggagtggg acgccgcgct gaacgcgctg       600
     acgcacctgg tcctgcccgc gtgcgcgctg gccaccatcc cgttcgcggt gatcttccgg       660
     atcaccaggg cggcggtgct cgacgtgctg aacgaggact acgtgcgcac cgccgagtcc       720
     aagggcctgc tgggcagcgt catccgccgc aggcacatcc tgcgcaacgc gatgctgccc       780
     gtggtcacca ccatcggcct gcagatcggc gcgctgctgg caggcgcggt gctcaccgag       840
     aaggtgttcg ccttccccgg cgtcggcgag gcgctggcca tcgggttcga gcgcagggac       900
     tacccggtcc tgcagatgtt catcctggtc gccgccatga tctacgtgct ggtgaacctg       960
     ctggtggacc tgtcgtacgc gctcatcgac cctcggatca gggcgaggta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page