(data stored in ACNUC7421 zone)

EMBL: CP001630.PE205

CP001630.PE205       Location/Qualifiers
FT   CDS_pept        231325..232257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0208"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3642 dipeptide ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34179"
FT                   /db_xref="GOA:C6WF47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF47"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34179.1"
FT                   /translation="MTPTTKKERIDALAESSASDSGVSLAASAWKRLRRSPVFLLGAAI
FT                   IALFLVVAAIAPWLAPHDPAARDLIDQVIKARNQIPGPQEGYPLGGDLVGRDLLSRLLV
FT                   GAQQTLLVGVFATLIGLAGGMVLGILAGAFGGWVDSLVMRVVDVMLSIPQLLLAFGIGA
FT                   LFARPSLLTVILAVSIVQIPVFARLLRGSMLAQRSSDHVLAATALGVKPGPIVFRHMLP
FT                   NSLGPVIVQSTLVLATSIIDAAALSFLGLGNPDDTIPEWGQMLGSAQTVIDSHPHLAFW
FT                   PAGCIIVIALGFTLVGESLRDALDPKNRR"
     atgaccccca ccacgaagaa ggagcggatc gacgctctcg ccgagagctc ggcctccgac        60
     tccggcgtca gcctcgccgc cagcgcctgg aagcggctgc ggcgcagccc ggtcttcctg       120
     ctcggcgcgg cgatcatcgc gctgttcctg gtcgtcgcgg cgatcgcgcc gtggctcgcc       180
     ccgcacgacc ccgcggcccg cgacctgatc gaccaggtca tcaaggcccg caaccagatc       240
     cccggcccgc aggagggcta ccccctcggc ggcgacctgg tcggccgcga cctgctgtcc       300
     cggctgctcg tcggcgccca gcagaccctg ctggtcggcg tgttcgccac gctgatcggc       360
     ctcgcgggcg gcatggtgct cggcatcctc gccggcgcgt tcggcggctg ggtcgactcg       420
     ctcgtcatgc gcgtcgtcga cgtcatgctg tcgatcccgc agctgctgct ggccttcggc       480
     atcggcgcgc tgttcgccag gcccagcctg ctcaccgtga tcctcgcggt gtccatcgtg       540
     cagatcccgg tgttcgcccg gctgctgcgc ggctcgatgc tcgcccagcg ctccagcgac       600
     cacgtgctgg ccgccaccgc gctcggcgtg aagcccggcc cgatcgtgtt ccggcacatg       660
     ctgccgaact cgctcggccc ggtcatcgtc cagtccaccc tggtgctggc cacgtcgatc       720
     atcgacgcgg cggcgctgtc gttcctgggc ctgggcaacc ccgacgacac gatccccgag       780
     tggggtcaga tgctcggcag cgcccagacc gtgatcgaca gccacccgca cctggccttc       840
     tggcccgcgg gctgcatcat cgtgatcgcg ctcggcttca ccctggtcgg tgagtccctg       900
     cgcgacgcgc tcgaccccaa gaacaggcgg tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page