(data stored in ACNUC7421 zone)

EMBL: CP001630.PE206

CP001630.PE206       Location/Qualifiers
FT   CDS_pept        232263..233258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0209"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:bll2870 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34180"
FT                   /db_xref="GOA:C6WF48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF48"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACU34180.1"
FT                   /translation="MALLEVRDLTVVFERKGEQPFTAVDGVSFDVEPGQTVGLVGESGC
FT                   GKSVTSLAIMGLLPKRGARITGSVGYEGTDLLKLSDRQMRDRRGRDLGMVFQDPLSSLN
FT                   PVIPIGLQVTEVLERHRGMARKQAMVEAADLLDKVGIPDPTRRLSEYPHQLSGGMRQRA
FT                   LIAIALACRPRLLIADEPTTALDVTIQAQILALLKELVQDTGTALVMITHDLGVVAGLC
FT                   DEVNVLYGGRVVEKARRHELFGQPRHPYTHGLLASIPRLDAPRGERLVPIKGSVADNIP
FT                   WEGGCAFAPRCPNALDVCVTTTPEQEDLGGGRLLRCHNPVRPEVAEEVGA"
     atggcactgc tggaagtccg cgacctcacc gtcgtcttcg agcgcaaggg cgagcagccc        60
     ttcaccgccg tggacggggt cagcttcgac gtcgagcccg gccagaccgt cggcctggtc       120
     ggtgagtccg gctgcggcaa gtcggtgacc tccctcgcga tcatgggcct gctgcccaag       180
     cgcggggcgc ggatcaccgg gtcggtcggc tacgagggca ccgacctgct gaagctgtcc       240
     gaccgccaga tgcgcgaccg gcgcgggcgc gacctgggca tggtgttcca ggacccgctg       300
     tcctcgctca acccggtcat cccgatcggc ctccaggtca ccgaggtgct ggagcggcac       360
     cggggcatgg cccgcaagca ggccatggtc gaggcggccg acctgctgga caaggtcggc       420
     atccccgacc cgacccggcg gctctccgag tacccgcacc agctgtccgg cgggatgcgc       480
     cagcgcgcgc tgatcgccat cgcgctcgcc tgccgccccc ggctgctcat cgcggacgag       540
     ccgaccacgg cgctggacgt gaccatccag gctcagatcc tggcgctgct caaggaactg       600
     gtgcaggaca ccgggaccgc gctggtcatg atcacgcacg acctgggcgt cgtcgccggc       660
     ctgtgcgacg aggtgaacgt gctctacggc ggtcgcgtcg tggagaaggc gcggcggcac       720
     gagctcttcg ggcagccgcg ccacccgtac acccacggcc tgctggcctc catcccgagg       780
     ctggacgcgc cgcgcggcga gcggctggtg cccatcaagg gctcggtcgc cgacaacatc       840
     ccgtgggagg gcggctgcgc gttcgcgccg cgctgcccga acgcgctgga cgtgtgcgtg       900
     acgaccacgc cggagcagga ggacctcggc ggcggcaggc tgctgcgctg ccacaacccg       960
     gtgcggcccg aggtcgcaga ggaggtgggc gcgtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page