(data stored in ACNUC7421 zone)

EMBL: CP001630.PE207

CP001630.PE207       Location/Qualifiers
FT   CDS_pept        233255..234397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0210"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34181"
FT                   /db_xref="GOA:C6WF49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF49"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACU34181.1"
FT                   /translation="MTAAEPVQAERAPEGDALISIEGIQVHFPIKRGVFLDRTVGHVYA
FT                   VDGVDLSIRKGETYGLVGESGCGKSTLGRAVLRLTEPTGGRVVFDGTDLSTLKGEALRT
FT                   MRQRMQMVFQDPMSSLDPRQSVESILVEGLRAHGLDKGKEATGKRLRELLAAVGLPSTS
FT                   LRKYPHEFSGGQRQRIGIARALAVEPDLIIADEPVSALDVSVQAQVVNLLEELQEKLGL
FT                   TYLVIAHDLAVVRHIADRVGVMYLGGIVEEASSDGLYAEPLHPYTRALLSAIPVPDPVV
FT                   EDRRERILLKGDLPSPANPPTGCRFHTRCPWRQATRCDTERPALREVLPGHRVACHWAE
FT                   DIRSGAIKPHEVEAVLVEEDGISPDVPLVGPASVTEVLNP"
     gtgaccgcgg cagaacccgt tcaggccgag cgggcccccg agggcgacgc cctcatctcg        60
     atcgagggca tccaggtcca cttcccgatc aagcggggcg tcttcctgga ccgcaccgtc       120
     ggccacgtgt acgcggtcga cggcgtggac ctgagcatcc gcaagggcga gacgtacggc       180
     ctggtcggcg agtccggctg cggcaagtcc acgctcggca gggccgtgct gcggctcacc       240
     gagccgaccg gcggccgggt cgtgttcgac ggcaccgacc tgtccacgct caagggcgag       300
     gcgctgcgca ccatgcggca gcggatgcag atggtcttcc aggacccgat gtcctcgctg       360
     gacccgcgcc agtcggtcga gtcgatcctg gtcgaggggc tgcgcgcgca cgggctggac       420
     aagggcaagg aggccaccgg caagcgcctg cgcgagctgc tggccgccgt gggcctgccg       480
     tcgacctcgc tgcgcaagta cccgcacgag ttctccggcg gccagcgcca gcgcatcggc       540
     atcgcccgcg cgctggcggt cgagcccgac ctgatcatcg ccgacgagcc ggtgtccgcg       600
     ctcgacgtgt cggtgcaggc gcaggtggtg aacctgctgg aggagctgca ggagaagctg       660
     gggctgacct acctggtgat cgcccacgac ctcgcggtcg tgcggcacat cgccgaccgg       720
     gtcggcgtca tgtacctggg cgggatcgtg gaggaggcga gctcggacgg gctgtacgcc       780
     gagccgctgc acccgtacac cagggcgctg ctgtcggcga tcccggtgcc ggaccccgtg       840
     gtggaggacc ggcgcgagcg catcctgctc aagggcgacc tgccctcgcc cgccaacccg       900
     ccgacgggct gccgcttcca cacgcggtgc ccgtggcggc aggcgaccag gtgcgacacc       960
     gagcggcccg cgctgcgcga ggtgctgccc ggccaccggg tggcctgcca ctgggcggag      1020
     gacatccgct ccggggcgat caagccgcac gaggtcgagg cggtgctggt ggaggaggac      1080
     gggatctccc cggacgtccc gctcgtcggg cccgcctcgg tcaccgaggt gctgaacccg      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page