(data stored in ACNUC7421 zone)

EMBL: CP001630.PE208

CP001630.PE208       Location/Qualifiers
FT   CDS_pept        234560..236698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0211"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: xom:XOO_3262 type I
FT                   restriction system adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34182"
FT                   /db_xref="GOA:C6WF50"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF50"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACU34182.1"
FT                   /translation="MGLQPKLLTAGGIAELLSVRASAISNWRKRHRDFPRPREAAGQEL
FT                   FDAAEVGRWLAGRRVPRTALRRDEAEGATYQHRFLRGVGRPAPVVERGPVAPGRAPALL
FT                   AHAEPLRVASGLGVDFPLGLLRLRVADPAGWGALVAAARGGAGARVRGLLVDARLPGAD
FT                   VEAGGALPAAVLAAVLAAVLAADAAEEPARVADALLSRPGRDAGHRTPPLARCLVELVD
FT                   PRPGETVHDPCCGDGRLLVAVAGHLAPESPGAGALSGRAADEVSSRVCAALLGIRGMSA
FT                   DLRAHGDGFRCELFDVVVAHPPVTLAPPGGEGPPLGEPSARGAGLAWVQHALRELAPGG
FT                   RAALLVPGSTASGQAGRDVAVRRALVEAGVVECVVALPGRSSRAVVWVLRAPGAGPVDP
FT                   EVLFVDAAGGGEPGGRVVDDAVVDRVVGEHRRRAERGGRRFAGQEGFSRSAARAEIARN
FT                   DFRLAPAGYVARPAAASAPLEHLLAEVDALRAELSGLRGAVAAREAEGERAFAAALAAT
FT                   GGVPRAEVPLGRIAEVAAGPGTMARGDGVPVVLPRNIGGGRVDRGAHDLAPARGDRYAL
FT                   RAGDVVCARTGTLGRGRSGGTGRYGVVGADQDGWLLGPGCLRLRPGTGVVPGYLAHFLN
FT                   SPEGAAGLERLLSGGAVPHVTTRAMGELVVRLPPTAAQTTIAAALDAADARLALHRRVE
FT                   DAERELRELTFAAPTHAR"
     gtgggcttgc agccgaagct gctgacggcg ggcgggatcg ccgagctgct gtcggtcagg        60
     gccagcgcga tcagcaactg gcgcaagcgg caccgggact tcccccggcc gcgcgaggcc       120
     gccgggcagg agctgttcga cgcggccgag gtcgggcggt ggctggccgg gcggcgggtc       180
     ccgcgcaccg cgctgcgccg cgacgaggcc gagggcgcca cctaccagca ccggttcctg       240
     cgcggcgttg ggcggcccgc gccggtggtc gagcgggggc ctgtcgcgcc tgggcgggcg       300
     cccgcgctgc tcgcgcacgc ggaaccgctg cgggtcgctt ccggcctggg cgtcgacttc       360
     ccgctggggc tgctgcgcct gcgcgtcgcc gatccggcgg gctggggcgc gctcgtggcc       420
     gccgctcggg gtggggcggg cgcgcgggtg cgcgggctgc tggtggacgc ccggctgccg       480
     ggggcggacg tcgaggcggg cggtgcgctg cccgcggccg tgctcgccgc cgtgctcgcg       540
     gccgtgctcg ccgccgacgc ggccgaggag cccgcgcggg tcgcggacgc gctgctctcc       600
     cggcccggcc gggacgccgg gcaccggacg ccgccgctgg cccgctgcct ggtcgagctg       660
     gtcgaccccc ggcccggtga gaccgtgcac gacccgtgct gcggtgacgg caggctgctg       720
     gtcgcggtcg ccgggcacct cgcccccgag agccccggcg ccggggcgct gtccgggcgg       780
     gctgccgacg aggtgtcgtc gcgcgtctgc gccgcgctgc tggggatcag gggcatgtcc       840
     gccgacctgc gcgcgcacgg ggacgggttc cggtgcgagc tgttcgacgt ggtcgtggcg       900
     cacccgccgg tcaccctcgc cccacccggc ggcgaggggc cgccgctcgg cgagccgtcc       960
     gcgcgcggcg ccggtctcgc ctgggtccag cacgcgctgc gcgagctcgc gcccggcggg      1020
     cgggccgcgc tgctcgtgcc gggcagcacc gcgtccgggc aggcgggccg ggacgtggcg      1080
     gtgcggcggg ccctggtcga ggccggggtc gtcgagtgcg tggtcgccct gccggggcgg      1140
     tcgtcccgcg cggtggtgtg ggtgctgcgc gcgcccggtg ctggaccggt cgacccggag      1200
     gtgctgttcg tcgacgcggc cggtggcggt gagccgggcg ggcgcgtggt ggacgacgcg      1260
     gtcgtcgacc gggtggtcgg cgagcaccgg cggcgggctg agcggggtgg gcggcggttc      1320
     gccgggcagg aggggttcag ccggtcggcg gcgcgggcgg agatcgcgcg caacgacttc      1380
     cggctcgcgc ccgccgggta cgtggcacgt cccgccgccg cgtccgcgcc gctggagcac      1440
     ctgctcgcgg aggtcgacgc gctgcgcgcc gagctgagcg ggctgcgggg cgcggtcgcc      1500
     gcgcgggagg ccgagggcga gcgggcgttc gccgccgcgc tggccgccac cgggggcgtg      1560
     ccgcgggcgg aggtcccgct cgggcggatc gccgaggtgg cggccgggcc ggggaccatg      1620
     gcgcgcgggg acggcgtgcc ggtggtgctg ccgcgcaaca tcggcggcgg gcgggtggac      1680
     cggggcgcgc acgacctggc gcccgcgcgg ggcgaccggt acgcgctgcg ggccggggac      1740
     gtggtgtgcg cccggacggg gacgctcggg cggggacgct cgggcggtac ggggcggtac      1800
     ggggtggtcg gggcggacca ggacgggtgg ctgctcgggc ccggctgcct gcggctgcgg      1860
     ccggggaccg gggtggtgcc ggggtacctg gcgcacttcc tgaactcgcc cgagggcgcg      1920
     gccggtctgg agcggctgct gtccggcggg gcggtcccgc acgtgaccac gcgggccatg      1980
     ggggagctgg tggtccggct gccgccgacg gccgcgcaga ccacgatcgc ggcggccctg      2040
     gacgccgccg acgcgcggct cgcgctgcac cggcgggtgg aggacgcgga gcgggagctg      2100
     cgcgagctga ccttcgcggc cccgacccac gcccggtga                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page