(data stored in ACNUC7421 zone)

EMBL: CP001630.PE209

CP001630.PE209       Location/Qualifiers
FT   CDS_pept        237187..237762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0212"
FT                   /product="putative membrane-associated protein"
FT                   /note="KEGG: pol:Bpro_3150 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34183"
FT                   /db_xref="GOA:C6WF51"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF51"
FT                   /inference="protein motif:COG:COG0586"
FT                   /protein_id="ACU34183.1"
FT                   /translation="MTPLLVLFAVAAVPLAPTEAVLIACGVLAASGELPLGAVIAVAAA
FT                   GCTVADLVNLAIGRALGGRALARFERRAGSRAVLDWTRARLAGRGEAVLVAVRFVPGGG
FT                   VVAALLVGALRWRALRFLPIAAVGSLLWSAYVGLLGYFGGTLLDDPVLALIASLAVATL
FT                   IGVPAGVAVRAAQRREALRDGGPEPLAV"
     gtgacaccac tgctggtgct gttcgccgtt gccgccgtgc cgctggcgcc gaccgaggcc        60
     gtgctgatcg cctgcggcgt gctcgcggcg tccggcgagc tgccgctcgg ggccgtgatc       120
     gccgtcgcgg cggcggggtg cacggtggcc gacctggtca acctcgccat cgggcgggcg       180
     ctcggcgggc gggcgctggc gaggttcgag cgcagggccg ggtcccgcgc ggtgctggac       240
     tggacccgcg cccggctggc cgggcggggc gaggcggtgc tggtggcggt gcggttcgtg       300
     cccggaggcg gggtggtggc cgcgctgctg gtgggcgcgc tgcgctggcg ggccctgcgg       360
     ttcctgccga tcgcggccgt cgggtcgctg ctgtggagcg cgtacgtggg actgctgggc       420
     tacttcggcg gcacgctcct ggacgacccc gtgctggccc tgatcgcctc gctcgcggtc       480
     gcgaccctca tcggggtgcc cgcgggcgtg gcggtgcgcg ccgcgcagcg cagggaggcg       540
     ctgagggacg gcgggccgga acccctggcc gtctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page