(data stored in ACNUC7421 zone)

EMBL: CP001630.PE21

CP001630.PE21        Location/Qualifiers
FT   CDS_pept        complement(21196..23241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0021"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: bha:BH2504
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33995"
FT                   /db_xref="GOA:C6WCH4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU33995.1"
FT                   /translation="MSTPRLLSNRYELGETLGYGGMSEVHKGKDVRLSRDVAIKVLRAD
FT                   LARDAQFQERFRREAQNSAALNHPAIVAVYDTGETETQYGPLPYIVMEYVDGRTLRDIV
FT                   KTQGPLSNKRAMEVMADVSAALDFSHRHGIVHRDVKPANVMITRSGAVKVMDFGIARAV
FT                   HDGQAAVTQTAAVIGTAQYLSPEQAKGEAVDGRSDVYASGCVLFELLTGEPPFTGDSPV
FT                   AVAYQHVREEPKSPSSLNPKVSPALDSIVLKAMAKGPANRYQSAAELRADLVRVLSGQR
FT                   PSAPVVMTSEERTALLDQQSASAPTRSEAVQTTSGGGRHRQSVVRERERERDREDTGNY
FT                   SAALEEERERLAARRRMWMITIVVLLCAGVLALAIWITTSLLGDNESSGGDPKQVTVPT
FT                   LIGKSTSEARGALSDAGLEINLQLVPCQPGSQPKCDPAKDVDRVLETSPTSGKSVDRNS
FT                   KITVMVGTNPDDVEVPDLTGLSVADAQAKLGEDWKLDTNQERVETSDPAKVDKVVEQNP
FT                   MHGTKAPKGTTITIKIGKEPEAVTLPNVIGVQEDDARSSLEQSGFKVQVKQVDSATDAG
FT                   QVIAQDPGAGRVEKGSTVTLSVSKGNMVSMPDLRGMTENEAKAALRQFQWNGDLQTTKT
FT                   PVSDLSQDRKVQSQQTSPGSAITKAQRITVVIGEFRPGASSTPPSN"
     atgagcactc cgcgactgct ctccaaccgc tacgaactcg gggagaccct cggctacggc        60
     ggcatgtccg aggtccacaa gggcaaggac gtgcggctca gccgggacgt ggcgatcaag       120
     gtgctccgcg ccgacctcgc ccgcgacgcc cagttccagg agcggttccg tcgtgaggcc       180
     cagaactccg cagcgctgaa ccaccccgcc atcgtcgccg tgtacgacac cggcgagacc       240
     gagacccagt acggcccgct gccctacatc gtcatggagt acgtggacgg gcggacgctg       300
     cgcgacatcg tcaagaccca ggggccgctg tcgaacaagc gcgccatgga ggtcatggcg       360
     gacgtgtcgg ccgcgctgga cttcagccac cggcacggca tcgtgcaccg cgacgtgaag       420
     cccgcgaacg tgatgatcac ccgttcgggc gccgtcaagg tcatggactt cggcatcgcg       480
     cgcgccgtgc acgacggcca ggccgccgtg acgcagaccg ccgcggtgat cggcaccgcc       540
     cagtacctgt cacccgagca ggcgaagggc gaggcggtcg acggccgcag cgacgtgtac       600
     gcgtcgggct gcgtgctgtt cgagctgctc accggcgagc ccccgttcac cggcgactcg       660
     ccggtcgcgg tggcctacca gcacgtgcgg gaggagccga agtccccgtc gtcgctgaac       720
     ccgaaggtgt cgcccgcgct ggactccatc gtgctcaagg cgatggccaa gggcccggcg       780
     aaccgctacc agtcggccgc cgagctgcgc gccgacctgg tccgcgtgct gtccggccag       840
     cggccgtccg cgcccgtcgt gatgacgagc gaggagcgga ccgcgctgct ggaccagcag       900
     tcggcctcgg cgcccacgcg cagcgaggcg gtgcagacga cgagcggcgg tggcaggcac       960
     cggcagtcgg tggtccgcga gcgggagcgg gagcgcgacc gcgaggacac cggcaactac      1020
     agcgccgcgc tggaggagga gcgggagcgc ctcgccgcgc gcaggcggat gtggatgatc      1080
     accatcgtcg tcctgctgtg cgcgggtgtg ctggcgctgg cgatctggat caccacctcg      1140
     ctgctcgggg acaacgagtc ctccggcggc gacccgaagc aggtcacggt gccgacgctg      1200
     atcggcaagt ccacctcgga ggcgcgcggc gcgctgtccg acgccgggct ggagatcaac      1260
     ctgcagctgg tgccgtgcca gccgggcagc cagcccaagt gcgacccggc caaggacgtc      1320
     gaccgggtgc tggagaccag ccccacgagc ggcaagtcgg tcgaccgcaa cagcaagatc      1380
     accgtcatgg tgggcacgaa ccccgacgac gtcgaggtcc ccgacctgac cggcctgagc      1440
     gtcgcggacg cgcaggccaa gctcggcgag gactggaagc tcgacacgaa ccaggagcgg      1500
     gtggagacca gcgacccggc gaaggtcgac aaggtcgtcg agcagaaccc gatgcacggc      1560
     acgaaggccc ccaagggcac cacgatcacg atcaagatcg gcaaggagcc cgaggccgtc      1620
     acgctgccga acgtgatcgg cgtgcaggag gacgacgcgc ggtcctcgct ggagcagtcg      1680
     ggcttcaagg tgcaggtcaa gcaggtcgac agcgccaccg acgcgggcca ggtcatcgcg      1740
     caggaccccg gcgcgggccg ggtcgagaag ggctccacgg tcaccctcag cgtgtccaag      1800
     ggcaacatgg tctcgatgcc ggacctgcgg ggcatgaccg agaacgaggc caaggcggcg      1860
     ctgcggcagt tccagtggaa cggcgacctg cagaccacca agacgccggt gagcgacctg      1920
     tcccaggacc gcaaggtcca gtcccagcag acctcccccg gctcggcgat caccaaggcg      1980
     cagcggatca ccgtcgtcat cggcgagttc cggccgggcg cgagcagcac tccccccagc      2040
     aactag                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page