(data stored in ACNUC7421 zone)

EMBL: CP001630.PE210

CP001630.PE210       Location/Qualifiers
FT   CDS_pept        complement(237857..239653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0213"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: csa:Csal_2535 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34184"
FT                   /db_xref="GOA:C6WF52"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF52"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ACU34184.1"
FT                   /translation="MSTISPDAYSTGTSRIRPPARPAPEGQPAWNPQRGTSMPVHRYRP
FT                   FHELVETVDLPDRTWPAKRITQAPQWCAVDLRDGNQALIDPMSPARKRKMFDLLVRMGY
FT                   KEIEVGFPAASQTDFDFVREIIEDGAVPDDVTIQVLTQCRPELITRTYESLRGAHKAIV
FT                   HFYNSTSVLQRKVVFRADRDRIKAIATDAARFALEEAKKYPETEFRYEYSPESYTGTEL
FT                   SYALEVCDAVSEIIAPTPELPMVINLPATVEMATPNVYADSIEWMSRHLARRDSIVLSL
FT                   HPHNDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVCLVTLGMNMFSQGVDPQIDFS
FT                   DIDEVRRTVEYCNQLPVHERHPYGGDLVFTAFSGSHQDAIKKGFEALEADAKDADKHVD
FT                   EYPWEVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYVMKSEHHLDLPRRLQVEFSRVI
FT                   QEVTDTQGGEVGPKEIWDAFADEYLQGVAPLRLLKHELSSDGTGSESIKTVLVVDGETQ
FT                   DVTGTGNGPIAAFVDALASVGYDVRVLDYSEHALSSGDDARAASYVECSVGDRVLWGVG
FT                   VDSSTVAASLRALVSAVNRANR"
     atgagcacca tctcgcccga cgcgtacagc accggcacca gccgcatccg ccctcccgcc        60
     cgcccggccc ccgagggcca gcccgcgtgg aacccgcagc gcggcacgtc catgccggtg       120
     caccgctacc gcccgttcca cgagctggtc gagaccgtcg acctgcccga ccgcacctgg       180
     cccgccaagc ggatcaccca ggccccgcag tggtgcgcgg tggacctgcg cgacggcaac       240
     caggcgctga tcgacccgat gtcgcccgcc cgcaagcgca agatgttcga cctgctggtg       300
     cgcatgggct acaaggagat cgaggtcggc ttcccggcgg catcgcagac cgacttcgac       360
     ttcgtccgcg agatcatcga ggacggcgcg gtcccggacg acgtcaccat ccaggtgctg       420
     acccagtgcc gccctgagct gatcacccgc acgtacgagt cgctgcgcgg cgcgcacaag       480
     gcgatcgtgc acttctacaa ctccacctcg gtgctccagc gcaaggtcgt gttccgcgcc       540
     gaccgcgacc ggatcaaggc gatcgccacc gacgcggcgc ggttcgcgct ggaggaggcg       600
     aagaagtacc cggagaccga gttccgctac gagtactcgc ccgagtccta caccggcacc       660
     gagctgagct acgcgctgga ggtgtgcgac gcggtctcgg agatcatcgc gcccaccccc       720
     gagctgccga tggtgatcaa cctgcccgcg accgtcgaga tggcgacgcc gaacgtgtac       780
     gccgactcga tcgagtggat gtcgcgccac ctggcccggc gtgactcgat cgtgctgtcg       840
     ctgcacccgc acaacgaccg gggcaccggc gtggccgccg ccgagctggg ctacctggcg       900
     ggcgcggacc gcatcgaggg ctgcctgttc ggcaacggcg agcgcaccgg caacgtgtgc       960
     ctggtgacgc tgggcatgaa catgttcagc cagggcgtcg acccgcagat cgacttctcc      1020
     gacatcgacg aggtccgccg cacggtcgag tactgcaacc agctgcccgt gcacgagcgg      1080
     cacccgtacg gcggcgacct ggtgttcacc gcgttctccg gcagccacca ggacgccatc      1140
     aagaagggct tcgaggcgct ggaggcggac gcgaaggacg ccgacaagca cgtcgacgag      1200
     tacccgtggg aggtcccgta cctgcccatc gacccgaagg acgtcggccg caactacgag      1260
     gcggtcatcc gggtcaactc ccagtccggc aagggcgggg tggcgtacgt gatgaagagc      1320
     gagcaccacc tggacctgcc gaggcggctg caggtggagt tctcgcgggt gatccaggag      1380
     gtcaccgaca cgcagggcgg cgaggtcggc ccgaaggaga tctgggacgc cttcgcggac      1440
     gagtacctgc agggcgtcgc gccgctgcgg ctgctgaagc acgagctgtc cagcgacggc      1500
     accggctcgg agtcgatcaa gaccgtgctg gtggtcgacg gcgagaccca ggacgtgacg      1560
     ggcaccggca acgggccgat cgccgcgttc gtggacgcgc tggcgtcggt gggctacgac      1620
     gtccgggtgc tggactactc ggagcacgcc ctgtcctccg gcgacgacgc ccgcgcggcc      1680
     tcgtacgtgg agtgctcggt gggcgaccgc gtgctgtggg gcgtgggcgt cgacagctcc      1740
     accgtggccg cgtcgctgcg ggccctggtg tcggccgtga accgcgccaa ccgctag         1797
//

If you have problems or comments...

PBIL Back to PBIL home page