(data stored in ACNUC7421 zone)

EMBL: CP001630.PE211

CP001630.PE211       Location/Qualifiers
FT   CDS_pept        239881..240186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34185"
FT                   /db_xref="GOA:C6WF53"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34185.1"
FT                   /translation="MSRWRSTTRASSGSYTAARVISGVGVVFAVIEVLFILMVLLGAES
FT                   TNAFFQFISQLANPLALFFPGLFQFSDESVELIVNYGLAAVFWLVVTSLLARLIAR"
     atgtccagat ggcgttccac cactcgtgcg agcagcggga gctacaccgc tgccagggtg        60
     atcagcgggg tcggggtcgt cttcgcggtc atcgaggtcc tgttcatcct catggtgctc       120
     ctcggggccg agtcgaccaa cgcgttcttc cagttcatct cgcagctggc caacccgctg       180
     gcactgttct tccccggttt gttccagttc tccgacgaga gcgtcgagct gatcgtcaac       240
     tacggtctcg cggccgtgtt ctggctggtc gtgaccagtc tgctggcacg gctgatcgct       300
     cgctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page