(data stored in ACNUC7421 zone)

EMBL: CP001630.PE212

CP001630.PE212       Location/Qualifiers
FT   CDS_pept        complement(240214..240846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0215"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ank:AnaeK_1659
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34186"
FT                   /db_xref="GOA:C6WF54"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF54"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACU34186.1"
FT                   /translation="MARNGAEQGGSGQGGLELAGVIADRWSPRAFDAGAALGEDEARSL
FT                   FEAARWAASHGNTQPARFLLARRGEPAHERVFAALSRGNRTWAGSASALVVAALATSDA
FT                   KGPLPNAEFGLGLAVQNLVLQAVQLGLVAHQMGGFDPEALREALSIPGDVRPVVVIAVG
FT                   REGDGSDLPEDLRAKDERPRKRKPLAETVFSGKWGEAAFTPETPATS"
     gtggcgcgga acggtgcgga gcagggcggt tcagggcagg gcggtctcga actggccggg        60
     gtgatcgcgg accggtggag ccccagggcg ttcgacgcgg gcgcggcgct cggcgaggac       120
     gaggcgcgct cgctgttcga ggcggcgcgg tgggcagcct cacacgggaa cacccaaccg       180
     gcccggttcc tgctcgcccg gcgcggcgaa ccggcgcacg agcgggtctt cgcggcgctc       240
     agccggggca accggacctg ggccgggtcg gcgtccgcgc tggtcgtggc cgcgctggcc       300
     acctcggacg ccaaggggcc gctgccgaac gcggagttcg ggctggggct ggcggtgcag       360
     aacctggtgc tccaggcggt gcagctcggg ctggtcgcgc accagatggg cggattcgac       420
     cccgaggcgc tccgggaggc gttgtccatt ccaggggacg tgcgcccggt ggtggtgatc       480
     gcggtcggcc gggagggcga cggctcggat ttgccggagg acctgcgcgc gaaggacgaa       540
     aggccccgca agcgcaagcc gctggccgag acggtgttct ccgggaaatg gggcgaagcc       600
     gctttcaccc cggaaactcc cgccacgtcg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page