(data stored in ACNUC7421 zone)

EMBL: CP001630.PE213

CP001630.PE213       Location/Qualifiers
FT   CDS_pept        complement(240873..242096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5370 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34187"
FT                   /db_xref="GOA:C6WF55"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34187.1"
FT                   /translation="MAGTTLVAVPTVDAGPDSPERAPSTRGPLAGLAEHRFAPVIAPGA
FT                   LYLLVRLLGVLVLALMSDHWDKDVAKVLTSWDGQWFLGIAQGGYGGVTPALVDAFGRRS
FT                   AETPLAFFPGYPLLVGWVGALPGVSAVGAAFSVSLVSGVFCAYGLHRLGRSVRGGSERA
FT                   GLVLVVLFAASPMAVVLSMAYSEALFCALAAWSLVGVVERRWVLAGLCAAGAGLVRPTA
FT                   GALVLAVGLAALVAVWQRRDGLRPWAGGVLAPLGMLGYLGFVAVRTGQLDGWFAVQQRG
FT                   WGSKFDGGAATWRFTWEILANPRSVLELVTVWLLLGALALVVVCVRRRLEWPLVVYAVG
FT                   VIVMDLGSNGLMNSKARLLLPAFALLLPIALSLAKRRTGAVVSVLAGVAVFGAWFGAYS
FT                   ITAWQYAI"
     gtggccggca ctaccctcgt cgccgtgccg accgtggacg caggaccaga cagccccgag        60
     cgcgcgccgt cgacgcgcgg acccctggcc ggcctggcgg agcaccggtt cgcgccggtc       120
     atcgcccccg gcgcgctcta cctgctggtg aggctgctcg gggtgctggt gctcgcgctg       180
     atgtccgacc actgggacaa ggacgtcgcg aaggtgctca cctcgtggga cgggcagtgg       240
     ttcctcggca tcgcgcaggg cgggtacggg ggcgtcaccc cggcgctggt ggacgcgttc       300
     ggcaggcgct cggcggagac gccgctggcg ttcttccccg gctacccgct gctggtgggc       360
     tgggtggggg cgctgccggg ggtgtcggcg gtgggcgcgg cgttctcggt gagcctggtg       420
     agcggggtgt tctgcgcgta cggcctgcac cggctggggc gctcggtgcg cggcgggtcg       480
     gagcgggccg ggctggtgct ggtggtgctg ttcgccgcct cgccgatggc cgtggtgctg       540
     tcgatggcct actcggaggc gctgttctgc gcgctggccg cgtggtcgct ggtgggcgtg       600
     gtggagcggc gctgggtgct ggccgggctg tgcgcggccg gggccgggct ggtgcggccg       660
     acggcgggcg cgctggtgct ggcggtgggg ctggccgcgc tggtggccgt gtggcagcgg       720
     cgggacgggc tgcggccgtg ggcaggcggg gtgctggcgc cgctcgggat gctgggctac       780
     ctcgggttcg tggcggtgcg caccgggcag ctggacggct ggttcgcggt gcagcagcgc       840
     ggctgggggt cgaagttcga cggcggggcg gcgacctgga ggttcacctg ggagatcctg       900
     gcgaacccga ggtcggtgct ggagctggtg acggtgtggc tgctgctggg cgcgctcgcg       960
     ctcgtggtgg tgtgcgtgcg gcggcggctg gagtggccgc tggtggtgta cgcggtgggc      1020
     gtgatcgtga tggacctggg ctcgaacggg ctgatgaact ccaaggcccg gctgctgctg      1080
     cccgcgttcg cgctgctgct gccgatcgcg ctgtcgctgg ccaagcggcg gacgggcgcg      1140
     gtggtgtcgg tgctggcggg tgtcgcggtg ttcggggcgt ggttcggggc gtactcgatc      1200
     accgcgtggc agtacgcgat ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page