(data stored in ACNUC7421 zone)

EMBL: CP001630.PE214

CP001630.PE214       Location/Qualifiers
FT   CDS_pept        242173..243438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0217"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tgr:Tgr7_1290 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34188"
FT                   /db_xref="GOA:C6WF56"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF56"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACU34188.1"
FT                   /translation="MALVVQKYGGSSVESAERIKRVAERIVATRKAGNDVVVAVSAMGD
FT                   STDELLDLAHQVAPVPPGRELDMLLTAGERISMSLLAMAISSLGASARSYTGSQAGVIT
FT                   TEVHGKARIIDVTPSRIQDALAEGHIAIVAGFQGVSQGTKEITTLGRGGTDTTAVALAA
FT                   ALKADVCEIYTDVDGVFTADPRIVPNAKRLESISYEEMLEMAACGAKVLMLRCVEYARR
FT                   YNVPVHVRSSFSNKPGTTVSGSVEDLPVEQAMITGVAHDRSEAKVTVTAVPDHPGVAAR
FT                   IFRVVAEAEIDIDMVVQNVSQAVSGRTDVTFTLPKDDGPRAVAALEKARGEIGFEKVIY
FT                   DDHVGKVSLIGAGMRSHPGVTATFCEALASAGVNIEIISTSEIRISVICRDTQLDDAVR
FT                   ALHDVFELGGDEEAVVYGGSGR"
     gtggcgctcg tcgtccagaa gtacggcggt tcctcggtgg agagcgccga gcggatcaaa        60
     cgggtggccg agcggatcgt cgcgacgcgc aaagcgggca acgacgtcgt cgtggcggtc       120
     tccgcgatgg gcgactcgac cgacgagctg ctcgacctcg cccaccaggt cgccccggtg       180
     ccgccgggcc gcgagctcga catgctgctc accgcgggcg agcgcatctc gatgtccctg       240
     ctggccatgg cgatcagctc cctcggcgcg tccgcccggt cctacaccgg ctcgcaggcg       300
     ggcgtgatca ccaccgaggt gcacggcaag gcgcgcatca tcgacgtgac gcccagccgc       360
     atccaggacg cgctcgccga gggccacatc gcgatcgtcg cgggcttcca gggcgtcagc       420
     cagggcacca aggagatcac cacgctcggc cggggcggca cggacaccac cgccgtcgcg       480
     ctggccgccg ccctcaaggc ggacgtgtgc gagatctaca ccgacgtgga cggcgtcttc       540
     accgccgacc cgcgcatcgt gcccaacgcc aagcggctgg agagcatctc ctacgaggag       600
     atgctggaga tggccgcctg cggcgccaag gtgctgatgc tgcgctgcgt cgagtacgcc       660
     cgccgctaca acgtgcccgt gcacgtccgc tcctcgttca gcaacaagcc ggggaccacg       720
     gtctccggat cagtggagga ccttcccgtg gaacaggcga tgatcaccgg cgtcgcgcac       780
     gaccggtccg aggccaaggt cacggtcacg gcggtgcccg accaccccgg cgtggccgcg       840
     cggatcttcc gcgtcgtcgc cgaggccgag atcgacatcg acatggtcgt gcagaacgtc       900
     tcgcaggccg tcagcggtcg caccgacgtg acgttcacgc tgcccaagga cgacggcccc       960
     cgcgcggtgg ccgccctgga gaaggcgcgc ggcgagatcg gcttcgagaa ggtcatctac      1020
     gacgaccacg tgggcaaggt gtcgctgatc ggcgcgggga tgcgctcgca ccccggcgtc      1080
     acggccacct tctgcgaggc gctggccagc gcgggcgtga acatcgagat catctccacc      1140
     tcggagatcc gcatctcggt catctgcagg gacacccagc tcgacgacgc cgtgcgcgcg      1200
     ctgcacgacg tgttcgagct cggtggcgac gaggaggctg tcgtgtacgg gggtagcggt      1260
     cgatga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page