(data stored in ACNUC7421 zone)

EMBL: CP001630.PE215

CP001630.PE215       Location/Qualifiers
FT   CDS_pept        243435..244502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0218"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: bcb:BCB4264_A3899 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerization region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34189"
FT                   /db_xref="GOA:C6WF57"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF57"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACU34189.1"
FT                   /translation="MSGGPVLALVGATGAVGTVMISIINNRETVPWGEIRLIASARSAG
FT                   KKIHVRGEDLTVVELTPEAFDGVDVAMFDVPDEVSARWAPIAAARGAVAVDNSGAFRMD
FT                   DEVPLVVPEVNADRIGDRPKGIIANPNCTTLSMMAAIGALHREFGLRELVVASYQAASG
FT                   GGQAAIDRLRAEVEAVSGKQVGERAGDVREALDAAGLPVSDSPFPAPLALNVVPWAGSL
FT                   KDDGWTSEELKVRNESRKILGIPDLKVSATCVRVPVVTTHSLAVHAVFERPVTVGQAHK
FT                   IFEEQPSVVLVDEPEAQRFPTPADVVGGDPTYVGRVRQALDFPNALDFFVCGDNLRKGA
FT                   ALNTYEIAEELAGRL"
     atgagcggcg gtccggtact ggcactggtc ggcgccaccg gcgcggtcgg cacggtgatg        60
     atctcgatca tcaacaaccg ggagaccgtg ccgtggggtg agatccggct gatcgcctcc       120
     gcgcgctcgg cgggcaagaa gatccacgtg cgcggcgagg acctcaccgt cgtcgagctg       180
     acccccgagg cgttcgacgg cgtcgacgtc gccatgttcg acgtgcccga cgaggtgtcc       240
     gcgcggtggg cgccgatcgc cgccgcgcgc ggcgcggtcg ccgtcgacaa ctccggcgcg       300
     ttccgcatgg acgacgaggt gcccctggtg gtgcccgagg tcaacgcgga ccggatcggc       360
     gaccgtccca aggggatcat cgccaacccc aactgcacga cgctgtcgat gatggccgcg       420
     atcggcgcgc tgcaccgcga gttcgggctg cgcgagctgg tcgtcgcctc ctaccaggcc       480
     gcgtccggcg gcgggcaggc cgcgatcgac cggctccgcg ccgaggtcga ggccgtctcc       540
     ggcaagcagg tcggcgagcg cgcgggcgac gtgcgcgagg cgctcgacgc ggcgggcctg       600
     ccggtgtccg actcgccgtt ccccgcgccg ctggcgctga acgtggtgcc gtgggccggg       660
     tccctcaagg acgacgggtg gaccagcgag gagctgaagg tccgcaacga gtcccgcaag       720
     atcctcggca tcccggacct gaaggtctcg gcgacctgcg tgcgggtgcc cgtggtgacc       780
     acgcactcgc tggccgtcca cgccgtgttc gagcggccgg tgaccgtcgg gcaggcgcac       840
     aagatcttcg aggagcagcc gtcggtcgtc ctggtggacg agccggaggc ccagcgcttc       900
     ccgacgcccg ccgacgtcgt gggcggcgac ccgacctacg tcggccgggt ccgccaggcg       960
     ctggacttcc cgaacgcgct cgacttcttc gtgtgcgggg acaacctgcg caagggcgcc      1020
     gccctcaaca cctacgagat cgccgaggaa ctggcgggca ggctgtag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page