(data stored in ACNUC7421 zone)

EMBL: CP001630.PE216

CP001630.PE216       Location/Qualifiers
FT   CDS_pept        244506..245936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0219"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG:
FT                   bcb:BCB4264_A2253 gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34190"
FT                   /db_xref="GOA:C6WF58"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF58"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACU34190.1"
FT                   /translation="MRDEGVVLAVDLGTTATKVVAVDLRARVLRSTERGYPMRTTPSGE
FT                   ATQDPDEVLAAALAAVSEVALACPEGVRALVLTGALHTLLGLDESGRPVTPSLSWADRR
FT                   AVEQVARLRAGDGVALHRATGTPVHTMSPLVKLRWFADHRVEAHRWCGLKDYVFAHLTG
FT                   VLATEHSSGSATGLMDLRALDWHPEALAHARVRADQLPELHAPTDSFPLRAAVDGVAPG
FT                   TPVVLGGGDGPLANLGVGAIVPGVAALSLGTSGALRVVSPEPAVDERGRVFCYAIGDGL
FT                   WTVGGAVSNGGVVASWAAESFGADVVELLDEAARVPVGASGVTALPYLLGERAPWWDAD
FT                   ATSAVVGLRREHGRAELTRALVEGVAQQLALVLDAVRSVAEVRLVRATGGALRHELWAS
FT                   VLCAALDVPLEITEDTGGSAVGAALLAWRSLGGLDSLAGTADLVFPERRYEPDPVAAAH
FT                   YAAARPGVERLYEALREL"
     gtgcgcgacg agggggttgt gctcgcggtc gacctgggga cgaccgcgac caaggtggtc        60
     gcggtcgacc tccgcgcacg ggtgctgcgc tcgaccgagc gcgggtaccc gatgcggacc       120
     acgccgtccg gggaggccac ccaggacccg gacgaggtgc tcgccgccgc gctggcggcg       180
     gtgtccgagg tggcgctggc ctgtcccgag ggcgtgcgcg cgctggtgct gaccggcgcg       240
     ctgcacacgc tgctcgggct cgacgagtcc ggcagaccgg tgaccccgtc cctcagctgg       300
     gcggaccggc gcgcggtcga gcaggtggcg cggctgcggg ccggggacgg cgtcgcgctg       360
     caccgggcca ccggcacgcc cgtgcacacc atgtcgccgc tggtgaagct gcgctggttc       420
     gccgaccacc gggtcgaggc gcaccggtgg tgcgggctga aggactacgt cttcgcccac       480
     ctgaccgggg tgctcgcgac cgagcactcg tccgggtcgg cgaccgggct catggacctg       540
     cgggcgctcg actggcaccc ggaggcgctc gcgcacgcgc gggtgcgcgc cgaccagctc       600
     cccgagctgc acgcgcccac cgactcgttc ccgctgcgcg cggccgtcga cggggtcgcc       660
     cccggcacgc cggtcgtgct cggcggcggt gacgggccgc tggccaacct gggcgtcggc       720
     gcgatcgtgc ccggtgtggc ggcgctgtcg ctgggcacca gcggggcgct gcgcgtggtg       780
     agccccgaac ccgccgtgga cgagcgcggc cgggtgttct gctacgccat cggcgacggg       840
     ctgtggacgg tcggcggggc ggtcagcaac ggcggcgtgg tcgcctcgtg ggcggccgag       900
     tcgttcggcg ccgacgtggt ggagctgctc gacgaggccg cgcgcgtgcc ggtcggcgcg       960
     tccggggtga cggcgctgcc gtacctgctg ggcgagcggg ccccctggtg ggacgctgac      1020
     gcgacgtcgg ccgtggtcgg gctccgccgc gagcacgggc gcgccgagct gaccagggcc      1080
     ctcgtggagg gcgtggcgca gcagctggcg ctggtgctgg acgcggtgcg gtcggtcgcc      1140
     gaggtgcgcc tggtgcgggc caccggcggc gcgctgcggc acgagctgtg ggcgtcggtg      1200
     ctgtgcgccg cgctggacgt cccactcgag atcacggagg acaccggagg ttcggccgtg      1260
     ggcgccgcgc tgctggcgtg gcgctcgctc ggcgggctgg actcgctggc gggcaccgct      1320
     gacctggtct ttccggagcg gcggtacgaa ccggacccgg tcgcggcggc gcattacgcg      1380
     gcggcgagac cgggcgtgga gcggttgtac gaagctcttc gggagctttg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page