(data stored in ACNUC7421 zone)

EMBL: CP001630.PE217

CP001630.PE217       Location/Qualifiers
FT   CDS_pept        246130..246333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0220"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: vsa:VSAL_II0614 cold shock-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34191"
FT                   /db_xref="GOA:C6WF59"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF59"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34191.1"
FT                   /translation="MATGKVKWFNAEKGFGFIEQDGGGPDVFVHFTAINASGYRSLEEN
FT                   QAVTFEVTQGPKGPQAENVQPA"
     gtggcaactg gcaaggtgaa gtggttcaac gccgagaagg gcttcggttt catcgagcag        60
     gacggcggtg ggccggacgt gttcgtgcac ttcaccgcaa tcaacgcctc cggctaccgg       120
     tccctggagg agaaccaggc cgtcacgttc gaggtgaccc agggtcccaa ggggccgcag       180
     gctgagaacg tccagcccgc ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page