(data stored in ACNUC7421 zone)

EMBL: CP001630.PE218

CP001630.PE218       Location/Qualifiers
FT   CDS_pept        complement(246436..247614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppg:PputGB1_3286 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34192"
FT                   /db_xref="GOA:C6WF60"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF60"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34192.1"
FT                   /translation="MSLNAYRSVLRTPQVVPTMLVVLLARIPITGVGMTLTMHVLLALD
FT                   HGYAAAGLVGMAATAGSAIGSPLLGRMLDRRGLRAVVGVSIVVEALFWLTAPLLSYPAL
FT                   LVTAFLSSLAALPVMSLGRQALTALVPESGRRTALALDSMAVELAFMAGPALGVFLGTH
FT                   WTGRPAMWVIGTAVVLSGLLLWVVDPPLRAGGAAPGGQAPRGWLDRRLVGVLISAGGAT
FT                   FLLTGVELATVAQMRAQGLTEWTGAAIVVMCAASLVGGFWYGGFERPVPVWALMAGMGV
FT                   LTLPLVLAGGSPWLLGPALALSSFLCAPTLTATGEAITTMAPEGARGTALGLQGAAFTL
FT                   GSALGQPVAGWAIDGVGPSAGFAVAALGSLAIAGLVVLLGVRGRTPEPVVAG"
     gtgagcctga acgcctaccg gtccgtgctg cgcacccccc aggtcgtccc gaccatgctg        60
     gtcgtgctgc tggcgcggat cccgatcacc ggcgtcggca tgacgttgac catgcacgtg       120
     ctgctcgccc tcgaccacgg ctacgccgcc gccggcctgg tcggcatggc ggccacggcg       180
     ggcagcgcga tcgggtcgcc gctgctgggg cggatgctgg accggcgcgg gctgcgcgcg       240
     gtggtcggcg tgtcgatcgt ggtggaggcc ctgttctggc tcaccgcgcc gctgctgtcc       300
     tacccggcgc tgctggtgac cgcgttcctg tcctcgctgg ccgcgctgcc ggtgatgagc       360
     ctgggcaggc aggcgctgac cgcgctggtg ccggagagcg gcaggcgcac cgcgctggcg       420
     ctggactcga tggcggtgga gctggcgttc atggcgggcc cggcgctcgg cgtgttcctg       480
     ggcacgcact ggaccgggcg gcccgcgatg tgggtgatcg gcacggccgt ggtgctgtcc       540
     gggctgctgc tgtgggtggt ggacccgccg ctgcgggccg gtggcgccgc gcccggcggg       600
     caggccccgc gcgggtggct ggaccggcgg ctggtcgggg tgctgatcag cgcgggcggc       660
     gcgacgttcc tgctgaccgg ggtcgagctg gcgacggtgg cgcagatgcg cgcccagggc       720
     ctgaccgagt ggaccggggc cgcgatcgtg gtgatgtgcg cggcgtccct ggtcggcggg       780
     ttctggtacg gcgggttcga gcgccctgtg ccggtctggg cgctcatggc cgggatgggg       840
     gtcctcaccc tgccgctggt gctcgcgggg ggctcaccgt ggctgctggg gcccgcgctg       900
     gcgctgtcga gcttcctgtg cgcgccgacg ctgacggcga ccggcgaggc gatcacgacg       960
     atggccccgg agggggcgcg cggcacggcg ctgggcctgc agggcgcggc gttcacgctg      1020
     gggtccgccc tcggccagcc ggtggcgggc tgggcgatcg acggcgtggg gccgtcggcc      1080
     gggttcgcgg tggcggcgct gggctcgctg gcgatcgccg ggctcgtggt gctgctgggc      1140
     gtccggggac ggacgccgga gccggtggtc gcgggctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page