(data stored in ACNUC7421 zone)

EMBL: CP001630.PE219

CP001630.PE219       Location/Qualifiers
FT   CDS_pept        247767..249221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0222"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: eta:ETA_17240
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34193"
FT                   /db_xref="GOA:C6WF61"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF61"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ACU34193.1"
FT                   /translation="MTDARPTTNNAGIPIASDDHSLTLGPNGPILLQDHYLIEKNAQFN
FT                   RERVPERVVHAKGGGAFGHFTTTADVSRYTKAALFQPGVRTEALLRFSTVAGELGSPDT
FT                   WRDPRGFALKLYTSQGNYDLVGNNTPVFFLRDPIKFPDFIRSQKRRVDTGRRDHDMQWD
FT                   FWTLQPETAHQVTWLMGDRGIPRTWRHQNGYGSHTYLWENAEGERHWVKYHFKTDQGIE
FT                   TLTADEAARIAGEDADAHRADLWHAVERGEFPSWTLHVQVMPYEDAAGYRFNPFDLTKV
FT                   WPQGDYPLIEVGKLVLDRNPSDHFAEIEQAAFEPTNLVPGIGASPDKMLLGRIFAYPDA
FT                   HRYRIGANYAQLPVNRPKSRVDSYAKDGAMRYGNASDPVYAPNSYGGPHASAAVGSEAT
FT                   TSYGVEDAVVRSAYRLHPEDDDWGQAGTLVREVMDDAQRDRLVETVVAHAGNGVSEPVL
FT                   RRVFEYWRNIDKGVGDRIAAAFDGRS"
     gtgaccgacg cacgtcccac caccaacaac gcgggaatcc cgatcgccag cgacgaccac        60
     tcgctgaccc tcggccccaa cgggccgatc ctgctccagg accactacct catcgagaag       120
     aacgcccagt tcaaccggga acgcgtcccc gaacgggtgg ttcacgccaa gggcggcggc       180
     gccttcggcc acttcaccac cacggccgac gtctcccgct acaccaaggc ggccctgttc       240
     cagcccggcg tgaggaccga ggcgctgctg cgcttctcca ccgtcgcggg cgagctgggc       300
     tccccggaca cctggcgcga cccccgcggc ttcgcgctca agctctacac cagccagggc       360
     aactacgacc tggtcggcaa caacaccccg gtgttcttcc tgcgcgaccc gatcaagttc       420
     cccgacttca tccgctccca gaagcgccgc gtcgacaccg gccgccgcga ccacgacatg       480
     cagtgggact tctggaccct ccagcccgag accgcccacc aggtcacctg gctcatgggc       540
     gaccggggca tcccgcgcac ctggcgccac cagaacgggt acggctcgca cacctacctg       600
     tgggagaacg ccgagggcga gcggcactgg gtgaagtacc acttcaagac cgaccagggc       660
     atcgagacgc tcaccgccga cgaggccgcc cggatcgcgg gcgaggacgc cgacgcgcac       720
     cgcgccgacc tgtggcacgc cgtcgagcgc ggcgagttcc cctcgtggac gctgcacgtg       780
     caggtcatgc cgtacgagga cgccgccggt taccggttca acccgttcga cctcaccaag       840
     gtgtggccgc agggcgacta cccgctcatc gaggtcggca agctggtgct ggaccgcaac       900
     ccgtccgacc acttcgccga gatcgagcag gccgcgttcg agcccaccaa cctggtgccc       960
     ggcatcgggg cctccccgga caagatgctg ctcggccgga tcttcgccta ccccgacgcg      1020
     caccggtacc gcatcggcgc gaactacgcg cagctgccgg tgaaccggcc caagtcgcgg      1080
     gtggactcgt acgccaagga cggcgcgatg cgctacggca acgccagcga cccggtgtac      1140
     gcgcccaact cctacggcgg cccgcacgcc tcggcggcgg tcgggtccga ggccaccacc      1200
     tcctacggcg tcgaggacgc cgtcgtgcgc tccgcgtacc ggctgcaccc cgaggacgac      1260
     gactggggcc aggcgggcac gctcgtgcgc gaggtcatgg acgacgccca gcgcgaccgg      1320
     ctggtcgaga ccgtggtcgc gcacgcgggc aacggggtgt ccgagcccgt gctgcgccgc      1380
     gtcttcgagt actggcgcaa catcgacaag ggagtcggcg accggatcgc cgcggccttc      1440
     gacggcaggt cctga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page