(data stored in ACNUC7421 zone)

EMBL: CP001630.PE22

CP001630.PE22        Location/Qualifiers
FT   CDS_pept        complement(23322..25025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0022"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_3649
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33996"
FT                   /db_xref="GOA:C6WCH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU33996.1"
FT                   /translation="MLSSGQLLAERYRLTRRIAVGGMGEVWEAADTRLDRNVAVKVLKA
FT                   ELSGDAEFLNRFRIEARTTASLNHPGIAGVHDYGETASEPDGPEDTAYLVMELVEGEPL
FT                   AAVIARGRMNAERVLDVLEQAGTALQAAHERGLVHRDVKPGNILVTPDGKVKITDFGIA
FT                   KAADAAPVTRSGMVMGTAHYIAPEQATGHDAEPASDVYALAVCGYECLVGHRPFRSENA
FT                   VTVAMMHIRDVAPPLPPDVPPAVRALIEATLVKDPRQRYRNGGEFASAVAAVRAGQPLP
FT                   APSGLAMAVGGPQLAPPPQAPPSQQLPVQQLQVQPMQAQPMQAQSMQAQPMQAQSMQAQ
FT                   PMSAPPMQAQPMSAPPMPQQPMPSQQLPAQLAPPQQLAAPPPVAPQQLTPPAQLTHPGI
FT                   PVTHPGSRPGMQPIHPPAAGPHTGAFHPPGAPGRHPGRGRPLLWVMVAFLVIALIALSV
FT                   LIVREIAGDDGVPGGPSPQGSTPSASRAAPEDATDRFPGRPTVEITGADYLGAPADEVA
FT                   ATLTGHGVEPEVRSERGGAPADARRCRVSELEPEGEVPIGSRVRVTCVPT"
     atgctgtcct ccggccagct cctcgccgag cggtaccgcc tcaccaggcg gatcgccgtc        60
     ggcggcatgg gtgaggtctg ggaggccgcc gacacccggt tggaccgcaa cgtcgcggtg       120
     aaggtgctga aggcggagct gagcggggac gccgagttcc tgaaccggtt ccgcatcgag       180
     gcccggacca ccgcgtcgct gaaccacccc ggcatcgccg gggtgcacga ctacggggag       240
     acggcctccg agcccgacgg gccggaggac accgcctacc tggtgatgga gctggtcgag       300
     ggcgagcccc tggccgcggt catcgccagg gggcggatga acgccgagcg ggtgctcgac       360
     gtgctggagc aggcgggcac cgcgctgcag gccgcgcacg agcggggcct ggtgcaccgg       420
     gacgtgaagc cggggaacat cctggtgacc ccggacggca aggtgaagat caccgacttc       480
     ggcatcgcga aggcggctga cgcggcgccg gtgacccggt cggggatggt gatgggcacg       540
     gcccactaca tcgcccccga gcaggcgacc gggcacgacg cggagccggc gagcgacgtg       600
     tacgcgctgg ccgtgtgcgg ttacgagtgc ctcgtcgggc accggccgtt ccggtcggag       660
     aacgcggtga ccgtggcgat gatgcacatc agggacgtcg cgccgccgct gccgccggac       720
     gtgccgcccg cggtgcgggc gctgatcgag gcgacgctgg tcaaggaccc gaggcagcgg       780
     taccgcaacg gcggcgagtt cgcctcggcg gtggccgcgg tgcgggcggg tcagccgctg       840
     cccgcgccgt ccgggctggc gatggcggtg ggcgggccgc agctggctcc cccgccgcag       900
     gcgccgccct cgcagcagct gcccgtgcag cagttgcagg tccagcccat gcaggcccag       960
     ccgatgcagg cgcagtccat gcaagcgcag ccgatgcagg cgcagtcgat gcaggcgcag      1020
     ccgatgagcg cgccgcccat gcaggcccag cccatgagcg cgccgccgat gccgcagcag      1080
     ccgatgccgt cgcagcagct cccggcgcag ctcgcgccgc cgcagcagct ggcggctccc      1140
     ccgccggtgg ccccgcagca gctcacgcca ccggcgcagc tcacccaccc cggcatcccc      1200
     gtgacgcacc ccggttcgcg tccggggatg cagcccatcc accctcccgc ggcaggcccg      1260
     cacacgggtg ctttccaccc gccgggcgct ccgggccggc atcctggacg cggtcgccct      1320
     ctgctgtggg ttatggtcgc cttcctggtg atcgcgctga tcgcactcag cgtgctcatc      1380
     gtgcgcgaga tcgcggggga cgatggggtg cccggcggtc cgagcccgca aggcagcacc      1440
     ccctccgcga gcagggccgc tccggaggac gcgaccgacc ggttccccgg caggcccacg      1500
     gtggagatca ccggggcgga ctacctcggc gcgcccgcgg acgaggtcgc ggcaaccttg      1560
     accgggcacg gcgtcgagcc cgaggtccgc tcggagcggg gcggcgcgcc cgcggacgcg      1620
     aggcggtgcc gggtgagcga gctggagccc gagggagagg tgccgatcgg ttcacgggtg      1680
     cgcgtcacgt gcgtgcccac ctga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page