(data stored in ACNUC7421 zone)

EMBL: CP001630.PE220

CP001630.PE220       Location/Qualifiers
FT   CDS_pept        249410..249832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0223"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bpy:Bphyt_6798 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34194"
FT                   /db_xref="GOA:C6WF62"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF62"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACU34194.1"
FT                   /translation="MNVLYTAEAIAVGDGRNGEVRSSDGVIDEQLAMPKELGGPGGDKT
FT                   NPEQLFAAGYAACFHSALKRVAGQAKADITDSTVTAKVGIGPNDQGGFGLTVELAVHIP
FT                   GADEAAAHKLVETAHQVCPYSNATRGNIEVALTTTV"
     atgaacgtgc tgtacaccgc cgaggcgatc gcagtgggcg acgggcgcaa cggcgaggtc        60
     cggtcctccg acggcgtgat cgacgagcag ctcgccatgc cgaaggagct cggcggcccc       120
     ggcggcgaca agaccaaccc cgagcagctg ttcgcggcgg gctacgcggc ctgcttccac       180
     agcgcgctca agcgggtcgc gggccaggcc aaggcggaca tcaccgactc cacggtcacc       240
     gccaaggtcg gcatcggccc caacgaccag ggcggcttcg gcctgaccgt cgagctcgcc       300
     gtgcacatcc ccggcgccga cgaggccgcg gcccacaagc tcgtcgagac cgcccaccag       360
     gtctgcccgt actccaacgc gacccgaggc aacatcgagg tggctctcac caccaccgtg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page