(data stored in ACNUC7421 zone)

EMBL: CP001630.PE221

CP001630.PE221       Location/Qualifiers
FT   CDS_pept        249865..250341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0224"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   mpo:Mpop_0322 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34195"
FT                   /db_xref="GOA:C6WF63"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF63"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACU34195.1"
FT                   /translation="MSKSPITSPLSDEAKDAVGHVLQATLVDLVDLSLVAKQAHWNVVG
FT                   KNFRSVHLQLDELVTTARTYADQVAERAAALGVTPNGKARTVAESSGVPEFPDGWLKED
FT                   DVVKAVVTTLAALIGRMRERIDETDKPDPVTQDLLIEITKQFEEAHWMWQAQQA"
     atgagcaagt ccccgatcac cagtccgctg tcggacgagg ccaaggacgc ggtcggccac        60
     gtcctgcagg ccaccctcgt ggacctggtc gacctgtccc tggtcgccaa gcaggcgcac       120
     tggaacgtgg tcggcaagaa cttccgcagc gtgcacctcc agctcgacga gctggtgacc       180
     accgcgcgga cctacgccga ccaggtggcc gagcgcgccg ccgccctggg cgtcacgccc       240
     aacggcaagg cgaggaccgt ggcggagtcc tccggggtgc cggagttccc ggacggctgg       300
     ctcaaggagg acgacgtcgt caaggccgtc gtcaccaccc tcgccgccct catcgggcgg       360
     atgcgcgagc gcatcgacga gaccgacaag ccggacccgg tcacccagga cctgctgatc       420
     gagatcacca agcagttcga agaggcccac tggatgtggc aggcccagca ggcctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page