(data stored in ACNUC7421 zone)

EMBL: CP001630.PE222

CP001630.PE222       Location/Qualifiers
FT   CDS_pept        complement(250415..250981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0225"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bpl:BURPS1106A_A1934 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34196"
FT                   /db_xref="GOA:C6WF64"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF64"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACU34196.1"
FT                   /translation="MTVTVVGIGGSLRANSSSERALRLVLSGAAETGARIVEVSGPDLV
FT                   LPFYDPTEPTRPEAARRLVEALRVADGVVLVSPGYHGTVSGLVKNALDYVEDLRGDERP
FT                   YLDGRAVGCVATAMGWQASVTTLTSLRSIVHALRGWPTPLGASVNTREVKFDEAGECSS
FT                   AEVAEQLRTVGRQVGEFAASRAKRW"
     atgacggtca ccgtggtggg catcggcggt tcgctccgcg ccaactcctc gtccgagcgc        60
     gcgctgcgcc tggtcctgtc cggcgcggcg gagaccggcg cgcggatcgt ggaggtgtcc       120
     ggcccggacc tggtgctgcc gttctacgac ccgaccgagc cgacccgccc ggaggccgcc       180
     cgcaggctgg tggaggcgct gcgcgtcgcg gacggcgtgg tgctggtgtc gcccggctac       240
     cacgggacgg tgtccgggct ggtcaagaac gccctggact acgtggagga cctgcgcggg       300
     gacgagcgcc cctacctgga cggcagggcg gtgggctgcg tggcgaccgc gatgggctgg       360
     caggcctcgg tgacgacgct gacctcgctg cgctcgatcg tgcacgccct gcgcggctgg       420
     ccgaccccgc tgggggcgtc ggtgaacacc cgcgaggtga agttcgacga ggcgggcgag       480
     tgctccagcg ccgaggtggc cgagcagctg cgcacggtcg gcaggcaggt gggcgagttc       540
     gccgcgagcc gcgcgaagcg gtggtga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page