(data stored in ACNUC7421 zone)

EMBL: CP001630.PE223

CP001630.PE223       Location/Qualifiers
FT   CDS_pept        251061..252113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0226"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rce:RC1_2418 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34197"
FT                   /db_xref="GOA:C6WF65"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF65"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACU34197.1"
FT                   /translation="MSKLADRVPTGVLAAGLRAAFALPAPVRRLLTGPPRVVHGQTLHP
FT                   DTQLLLRMQELSGTGWSTSSPATSRASLRRTTALVEGPGPHRVVTRQVLVDEHLKARHY
FT                   TPQGLPEGSPLLVFLHGGGWVSGDLETHDDLCRHLAVGAGVRVLAVDYRLAPEHRFPAA
FT                   ADDADAAYRYAVANAEELGADPDRIALGGDSAGGNLAASAALSAADADHRPAFLLLLYP
FT                   SLDATATGGSRDLFARGFFLTRPKMDWFMGNYAPDPSTHHDPRLSPLLAPDLSVLPPTY
FT                   VATAGLDPLRDEGEAFAARLAESGVPVVLRRHDGLIHGFANVLGVGTAGREAVAEAIGA
FT                   LRTGLALRRA"
     atgtcgaagc tcgccgacag ggtccccacc ggagtgctgg ccgcgggcct gcgcgccgcg        60
     ttcgccctgc ccgccccggt ccgccgactc ctcaccggac cgccccgcgt ggtccacggc       120
     caaaccctcc acccggacac ccagctgctg ctgcgtatgc aggagctgtc cggcacgggc       180
     tggtccacct cgtccccggc caccagccgc gcctcgctcc gccgcaccac ggccctcgtc       240
     gagggccctg ggccgcaccg ggtcgtcacc aggcaggtgc tggtcgacga gcacctcaag       300
     gccaggcact acaccccgca ggggctgccc gagggctccc cgctgctggt gttcctgcac       360
     ggcggcggct gggtcagcgg cgacctggag acccacgacg acctgtgccg ccacctcgcg       420
     gtgggcgcgg gcgtgcgcgt gctggcggtc gactaccggc tcgcccccga gcaccggttc       480
     cccgcagccg ccgacgacgc cgacgccgcc taccggtacg ccgtcgccaa cgccgaggag       540
     ctcggcgccg accccgaccg catcgcgctc ggcggcgaca gcgcgggcgg caacctcgcc       600
     gcctcggccg cgctcagcgc cgccgacgcc gaccaccggc ccgcgttcct gctgctgctc       660
     tacccctcgc tcgacgccac cgccaccggc ggctcccgcg acctgttcgc gcgcggcttc       720
     ttcctcaccc ggcccaagat ggactggttc atgggcaact acgcccccga cccgtccacc       780
     caccacgacc cgaggctctc gccgctgctc gccccggacc tgtccgtcct gccgccgacc       840
     tacgtggcca cggcggggct cgacccgctg cgcgacgagg gcgaggcgtt cgcggccagg       900
     ctcgcggaga gcggcgtgcc ggtcgtgctg cgcaggcacg acgggctgat ccacggcttc       960
     gccaacgtgc tcggcgtcgg cacggccggg cgggaggccg tcgccgaggc gatcggcgcg      1020
     ctgcgcaccg ggctcgcgct gcggcgggcg tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page