(data stored in ACNUC7421 zone)

EMBL: CP001630.PE224

CP001630.PE224       Location/Qualifiers
FT   CDS_pept        complement(252213..254027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0227"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S15; KEGG: pzu:PHZ_c2763
FT                   dipeptidyl aminopeptidase/acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34198"
FT                   /db_xref="GOA:C6WF66"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF66"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACU34198.1"
FT                   /translation="MTTHPTAPVPDPLFPDPEAEARWRDRFTAPRVSLPQWAEDAPDRN
FT                   LYLSNSSGVWEVYAWDRASDEHRKVTDRPNGTSHAALTPDGERIWWFSDTDGDEFGVWV
FT                   TEPFTATGDKAEPAVPDVPAAYPAGLGIGDEVVVIGASTDDGTTVYLSRAGGPAEVLYR
FT                   HANDAGLGALSKDETLVAIAHSEHGDNRHTALRVLTTSGETAAEKWDGPGKGLDAIAFS
FT                   PVRGDNRLLVMHERRGREELLVWDVAADAETEVVVDLPGEISADWYPEADALLVVHTFR
FT                   ARNTLHRYDLATGALTALETPHGSVGSVGVRPDGDVEYSWSSAARPGVVRVLTASGEDR
FT                   VLLSPAGHRPPPSAELRDVFVGDVHALVARPEGAPDGPLPTVFSLHGGPHAADEDRFSA
FT                   YRAVWLDAGFAVVHVNYRGSTGYGSAWRDAIEGRPGLTELEDVAAVHDWAVREGFADPA
FT                   RCVVNGASWGGYLSLLALGTQPERWAAGVAGVPVADYLAAYEDEMEPLRAFDRALFGGS
FT                   PQEVPERYRLCSPLTYVDEVRAPVLVLAGENDPRCPIRQIDNYLDRLAARGSEYEVYRY
FT                   DAGHGSLVVAETIAQTAAEVDFVRRRLG"
     gtgacgacgc acccgacagc tccagtcccg gacccgctgt tccccgaccc cgaggcggag        60
     gcccgctggc gggaccgctt caccgcgccc agggtgagcc tgccccagtg ggcggaggac       120
     gcgccggacc ggaacctgta cctgtcgaac tccagcggcg tgtgggaggt ctacgcctgg       180
     gaccgggcgt ccgacgagca ccgcaaggtc accgaccgcc ccaacggcac ctcgcacgcc       240
     gcgctcaccc cggacggcga gcggatctgg tggttctccg acacggacgg cgacgagttc       300
     ggcgtgtggg tgaccgagcc gttcaccgcg acgggtgaca aggccgagcc cgcggtgccg       360
     gacgtcccgg ccgcctaccc ggcgggcctg ggcatcggcg acgaggtcgt ggtcatcggc       420
     gcgtccaccg acgacggcac caccgtctac ctctcgcgcg cgggcggccc cgccgaggtg       480
     ctctaccggc acgcgaacga cgcggggctc ggcgcgctgt ccaaggacga gacgctggtc       540
     gcgatcgcgc actccgagca cggcgacaac cggcacaccg cgctgcgcgt gctgaccacc       600
     tcgggcgaga ccgcggcgga gaagtgggac ggccccggca agggcctgga cgcgatcgcg       660
     ttcagcccgg tgcgcggcga caaccggctg ctggtgatgc acgagcgccg gggccgcgag       720
     gagctgctgg tctgggacgt ggccgcggac gccgagaccg aggtcgtggt ggacctgccc       780
     ggcgagatct ccgccgactg gtacccggag gcggacgcgc tgctggtggt gcacaccttc       840
     cgggcgcgca acacgctgca ccgctacgac ctggcgaccg gcgcgctgac cgcgctggag       900
     accccgcacg gctcggtggg ctcggtcggg gtgcggccgg acggcgacgt ggagtactcg       960
     tggtcgtcgg ccgcgcgccc cggcgtggtg cgggtgctga ccgcgtccgg cgaggaccgg      1020
     gtgctgctct cgcccgcagg tcaccggccg ccgccgtcgg ccgagctgcg cgacgtgttc      1080
     gtcggcgacg tgcacgccct ggtcgccagg ccggagggcg cgccggacgg cccgctgccg      1140
     acggtgttca gcctgcacgg cgggccgcac gcggcggacg aggaccggtt ctcggcgtac      1200
     cgggcggtgt ggctggacgc cgggttcgcg gtggtgcacg tgaactaccg gggctccacc      1260
     gggtacggct cggcgtggcg ggacgccatc gagggcaggc cggggctgac cgagctggag      1320
     gacgtcgccg cggtgcacga ctgggccgtg cgcgagggct tcgcggaccc ggccaggtgc      1380
     gtggtcaacg gcgcctcgtg gggcgggtac ctgtcgctgc tggcgctggg gacgcagccg      1440
     gagcgctggg cggccggggt cgcgggcgtg ccggtggcgg actacctggc ggcgtacgag      1500
     gacgagatgg agccgctgcg ggcgttcgac cgggcgctgt tcggcgggtc gccgcaggag      1560
     gtgccggagc ggtaccggct gtgctcgccg ctgacctacg tggacgaggt gcgcgcgccg      1620
     gtgctggtgc tggcgggcga gaacgacccg aggtgcccga tccggcagat cgacaactac      1680
     ctggaccggc tcgcggcgcg gggctcggag tacgaggtgt accggtacga cgccgggcac      1740
     gggtcgctgg tggtggcgga gacgatcgcg cagaccgccg ccgaggtcga cttcgtgcgg      1800
     cgcaggctgg gctga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page