(data stored in ACNUC7421 zone)

EMBL: CP001630.PE225

CP001630.PE225       Location/Qualifiers
FT   CDS_pept        complement(254024..254854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0228"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Cyclopropane-fatty-
FT                   acyl-phospholipid synthase; Methyltransferase type 12;
FT                   KEGG: hha:Hhal_0984 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34199"
FT                   /db_xref="GOA:C6WF67"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF67"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34199.1"
FT                   /translation="MDPATPPQAPAPDHRADHRAELRRAYATGELAGLPVFGGGFINFG
FT                   FWRGIPLHGPLSAEDRVASQAALYDLVLDALSPTGRSTLEIGCGQGVGALRVLLRAPSR
FT                   CAGVDQEPEQVGRARLAAPEGEFAVGSAGALPFGDGEFERLLSVEAAQHFDDLGAFARE
FT                   AARVLSPGGRLAVATFFAADASAAPELSRLLATFARGLDLPHPIGGFLDRLREAGFGDV
FT                   AATSVGEHVWRGLDRWLELGPAPERWDRNWLVAAERGLLDYHLVTATKPAGSGV"
     gtggaccccg cgaccccgcc ccaggcccct gcccccgacc accgcgccga ccaccgcgcc        60
     gagctgcgcc gcgcctacgc caccggcgag ctcgccgggc tccccgtgtt cgggggcggc       120
     ttcatcaact tcggcttctg gcggggcatc cccctccacg gcccgctgtc cgccgaggac       180
     cgcgtcgcct cccaggccgc cctctacgac ctcgtgctcg acgccctctc ccccaccggc       240
     cgcagcaccc tggagatcgg gtgcgggcag ggggtgggcg cgctgcgggt gctgctccgg       300
     gcgccctccc ggtgcgccgg ggtcgaccag gagcccgagc aggtcgggcg ggcccgcctg       360
     gcggcgcccg agggggagtt cgcggtcggg tcggcggggg cgctgccgtt cggggacggc       420
     gagttcgagc gcctgctgtc ggtggaggcc gcgcagcact tcgacgacct cggcgcgttc       480
     gcccgcgagg cggcccgcgt gctctccccc ggcggtcggt tggccgtcgc cacgttcttc       540
     gccgccgacg cctccgcggc gcccgagctg tcccggctgc tggccacgtt cgcccgcggc       600
     ctcgacctgc cccacccgat cgggggcttc cttgaccggt tgcgcgaggc cgggttcggc       660
     gacgtggcgg ccacgagcgt gggcgagcac gtgtggcgcg gcctggaccg ctggctggag       720
     ctggggcccg cgcccgagcg gtgggaccgc aactggttgg tcgccgccga gcgggggctg       780
     ctggactacc acctggtcac cgcgaccaag ccggcaggat cgggggtgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page