(data stored in ACNUC7421 zone)

EMBL: CP001630.PE227

CP001630.PE227       Location/Qualifiers
FT   CDS_pept        complement(256654..257529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34201"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34201.1"
FT                   /translation="MPNLSRVDQVKRAIDRACSLHKSTGVRRTGLDRALGPELRALWGV
FT                   GGSDSPDRVRAKAVLQLERVFAGLDPVVAAVARGWFNTSLDPAWWELNLTGRKRRLREG
FT                   LDLSQRTLERRFGDEAQPALIASLRAGPAPVPPADVLARLDAERRAVAGDPPDDGADER
FT                   IGRFREPVPPLEQALRFAREEPLHGLRDREGRPVVLDAGGHGAWMPVFSTRARLREYLL
FT                   ANPAFDGFAFTSTGPKLAAELTARHPGTGLAVNPVADPEGNLGRTFTLLPEQVWELLPI
FT                   RRSPGENRAG"
     gtgcctaatc tgtcgcgcgt ggaccaggtc aagcgcgcga tcgaccgggc gtgctcgctg        60
     cacaagtcga ccggggtgcg gcggacgggg ctggaccggg cgctggggcc ggagctgcgg       120
     gcgctgtggg gcgtcggcgg ttccgactcg ccggaccggg tcagggcgaa ggcggtgctc       180
     cagctggagc gggtgttcgc cgggctggac ccggtggtgg cggccgtggc gcgggggtgg       240
     ttcaacacct cgctggaccc ggcctggtgg gagctgaacc tgaccgggcg caagcggcgg       300
     ctgcgcgaag ggctggacct gtcgcagcgc accctggagc gccggttcgg cgacgaggcg       360
     cagcccgcgc tgatcgcgtc gctgagggct ggacctgcgc cggtgccgcc cgcggacgtg       420
     ctggcccggc tggacgcgga gcggcgcgcg gtggcgggcg acccgccgga cgacggggct       480
     gacgagcgga tcgggcgctt ccgcgaaccg gtccccccgc tggagcaggc gctgcggttc       540
     gcgcgcgagg aaccgctgca cgggctgcgg gaccgggagg ggcgcccggt cgtgctggac       600
     gccggggggc acggggcgtg gatgccggtg ttcagcacgc gcgcccggct gcgggagtac       660
     ctgctggcga acccggcgtt cgacgggttc gcgttcacca gcacgggtcc gaaactcgcc       720
     gcggaactca ccgcgcggca tccgggaacg gggctcgcgg tgaatccggt ggccgatccc       780
     gagggaaacc tggggagaac attcaccctt ctcccggaac aggtctggga actgctcccg       840
     attcggcgtt cacccggtga aaaccgcgcc ggataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page