(data stored in ACNUC7421 zone)

EMBL: CP001630.PE228

CP001630.PE228       Location/Qualifiers
FT   CDS_pept        complement(258162..259121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0233"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hch:HCH_04892
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34202"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF70"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACU34202.1"
FT                   /translation="MNTFGRSLLATTALGTAALAYAAGIERRHWTLRRATIPVLAPGST
FT                   PLKVLHFSDLHMTPNQTSKQRWVAGLAELEPDLVVNTGDNLAHPQAVPGVIRALGPLLD
FT                   FPGVFVFGSNDYYAPRPKNPARYLLPSAKTKRIHGLDLPWRDLRAAMVERGWIDLTHVR
FT                   TSFEAGGQRIVAAGLDDPHLKRDRYSEIAGAPGKAALRLGVTHSPEPRVLDPFAADGYD
FT                   LVLAGHTHGGQLRVPGYGALVTNCDLDRGRARGVSRWGAHMWLNVSAGLGTSPYAPVRF
FT                   ACPPEASLLTLVPRDVDAGQSDDEAKRDTDFRVRGNVR"
     gtgaacacgt tcggccgatc cctgctcgcc acgaccgcac tcggaaccgc ggccctcgcc        60
     tacgcggcgg gcatcgagcg caggcactgg acactgcggc gcgccacgat cccggtgctg       120
     gcacccggtt cgacgcccct gaaggtgctg cacttctcgg acctgcacat gaccccgaac       180
     cagacctcga agcagcgctg ggtcgccggg ctcgccgagc tggagcccga tctcgtcgtc       240
     aacaccggcg acaacctcgc gcacccgcag gccgtccccg gcgtcatccg cgcgctcggc       300
     ccgctgctgg acttccccgg cgtgttcgtg ttcggcagca acgactacta cgcgccgcgc       360
     ccgaagaacc cggcgcgcta cctgctgccg tccgcgaaga ccaagcgcat ccacgggctc       420
     gacctgccgt ggcgcgacct gcgcgccgcc atggtggagc gcggctggat cgacctgacc       480
     cacgtgcgga cctcgttcga ggcgggcggt cagcggatcg tcgccgccgg cctggacgac       540
     ccgcacctca agcgcgaccg gtactccgag atcgcgggcg cgcccggcaa ggccgcgctg       600
     cggctgggcg tcacgcactc gccggagccg agggtgctgg acccgttcgc cgccgacggc       660
     tacgacctgg tgctcgcggg ccacacgcac ggcgggcagc tgcgcgtccc cggctacggg       720
     gcgctcgtga ccaactgcga cctcgaccgc ggccgggccc gcggcgtgtc ccggtggggc       780
     gcgcacatgt ggttgaacgt ctccgcgggc ctcggaacct cgccctacgc gccggtccgc       840
     ttcgcctgcc cgccggaggc cagcctgctc accctcgtcc cccgcgacgt cgacgctggt       900
     cagagcgacg acgaagcgaa gagggatacc gatttccgag ttcgtgggaa cgtgcggtag       960
//

If you have problems or comments...

PBIL Back to PBIL home page