(data stored in ACNUC7421 zone)

EMBL: CP001630.PE229

CP001630.PE229       Location/Qualifiers
FT   CDS_pept        259185..259652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0234"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="KEGG: mxa:MXAN_5202 GatB/YqeY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34203"
FT                   /db_xref="GOA:C6WF71"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF71"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5202"
FT                   /protein_id="ACU34203.1"
FT                   /translation="MAQLKARLQSDLTGAMKNRESVTAGALRMALTAVTNEEVSGKTAR
FT                   ELTDDEVLKVLGREVKKRREAAEAFANAGRDEKAELERQELAILEAYLPKQLDDAELAA
FT                   LVDEAVAELAQGGEQPGLKQMGLVMKAANAKVAGRAEGGRVAAAVKARLNA"
     atggcacagc tcaaggcgcg gttgcagtcc gatctgaccg gcgccatgaa gaacagggag        60
     tcggtcacgg cgggcgcgct gcggatggcg ctgaccgcgg tgaccaacga ggaggtctcg       120
     ggcaagacgg cgcgcgagct caccgacgac gaggtcctca aggtcctcgg ccgcgaggtg       180
     aagaagcgcc gcgaggccgc cgaggccttc gcgaacgcgg gccgggacga gaaggccgag       240
     ctggagcgcc aggagctggc gatcctggag gcctacctcc cgaagcagct cgacgacgcc       300
     gagctggccg cgctcgtcga cgaggcggtc gccgaactgg cgcagggcgg cgagcagccg       360
     ggcctgaagc agatgggcct cgtcatgaag gcggccaacg cgaaggtcgc cggtcgcgcc       420
     gagggcggcc gggtcgccgc cgccgtgaag gcccgcctga acgcctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page