(data stored in ACNUC7421 zone)

EMBL: CP001630.PE23

CP001630.PE23        Location/Qualifiers
FT   CDS_pept        complement(25025..26491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0023"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: penicillin-binding protein 2; K05515 penicillin
FT                   binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33997"
FT                   /db_xref="GOA:C6WCH6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH6"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACU33997.1"
FT                   /translation="MNTPLRRVGVAMMVMMMILLANATYVQVIKAEEYRTSPYNVRGRL
FT                   EMLSRERGSIIAADGTPLATVTPIPDKDRWQRVYANGPMYLPVTGYLSNTYGSNGLERA
FT                   ENDLLIGEDDRLFTRRLSDLITGRDPKGASLQVTINPKAQQAAYEALGDRTGAVVAIEP
FT                   KTGKILALVSTPSFDPNKLAVQDGQEEKAYWAEVTQDNPAQPDANRALSWTYPPGSTFK
FT                   LVVAAAGLEEGMDKSTQVDARPTITLPGTNTELPNFNGTNCNNGVNATLEQAIAQSCNT
FT                   AFAKLAGDLGTAKLREQAAKFGIDDQKYQVPMTTAASTLGPVPDQAALFQTGIGQRDVQ
FT                   VTPLANAVMVATIANKGVRMKPYLVDKILGTDTATVDETKPDEVDEAISEDSAQLLTEM
FT                   MIAAENKAGGAGKLSNIQIASKTGTAEWGVGSTPNPHAWYTAFAPANDPQIALAVIVEK
FT                   SGGKRDGAATGSLVAAPVGRAVISSYLGSR"
     atgaacaccc cgctccgccg agtcggcgtc gcgatgatgg tcatgatgat gatcctgctc        60
     gcgaacgcga cgtacgtgca ggtcatcaag gccgaggagt accggaccag cccgtacaac       120
     gtccggggca ggctggagat gctctcccgc gagcgcggca gcatcatcgc cgcggacggg       180
     acgccgctgg ccacggtcac gccgatcccg gacaaggacc gctggcagcg ggtctacgcc       240
     aacgggccga tgtacctgcc ggtgaccggc tacctgtcca acacctacgg ctccaacggg       300
     ctggagcggg ccgagaacga cctgctgatc ggcgaggacg accggctgtt cacgcgcagg       360
     ctgtccgacc tgatcaccgg ccgcgacccc aagggcgcga gcctccaggt gacgatcaac       420
     ccgaaggctc agcaggccgc gtacgaggcg ctgggcgacc ggaccggcgc ggtcgtggcg       480
     atcgagccga agaccggcaa gatcctggcg ctggtgagca cgccctcgtt cgacccgaac       540
     aagctggccg tgcaggacgg ccaggaggag aaggcgtact gggccgaggt cacgcaggac       600
     aacccggcgc agcccgacgc caaccgcgcc ctgtcctgga cctacccgcc cggctcgacg       660
     ttcaagctgg tcgtggcggc ggcgggcctc gaagagggca tggacaagtc gacccaggtc       720
     gacgcgcggc ccaccatcac gctgccgggc acgaacaccg agctgccgaa cttcaacggc       780
     accaactgca acaacggcgt caacgccacg ctggagcagg cgatcgccca gtcgtgcaac       840
     accgcgttcg cgaagctcgc gggcgacctc ggcacggcga agctgcgcga gcaggccgcg       900
     aagttcggca tcgacgacca gaagtaccag gtcccgatga ccacggcggc ctccacgctc       960
     ggcccggtcc cggaccaggc cgcgctcttc cagaccggca tcggccagcg cgacgtccag      1020
     gtgacgccgc tggcgaacgc ggtgatggtc gcgaccatcg cgaacaaggg cgtccgcatg      1080
     aagccctacc tggtggacaa gatcctcggc accgacacgg cgaccgtcga cgagacgaag      1140
     ccggacgagg tcgacgaggc catctccgag gacagcgccc agctgctgac cgagatgatg      1200
     atcgccgccg agaacaaggc cggtggcgcg ggcaagctca gcaacatcca gatcgcgtcg      1260
     aagaccggca ccgccgagtg gggcgtgggc tcgaccccga acccgcacgc ctggtacacc      1320
     gcgttcgccc cggcgaacga cccgcagatc gcgctcgcgg tcatcgtcga gaagagcggc      1380
     ggcaagcggg acggcgccgc gacgggcagc ctggtggccg cgcccgtcgg tcgcgcggtg      1440
     atcagcagct acctcgggag caggtga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page