(data stored in ACNUC7421 zone)

EMBL: CP001630.PE230

CP001630.PE230       Location/Qualifiers
FT   CDS_pept        complement(259758..262250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0235"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; PASTA domain
FT                   containing protein; penicillin-binding protein
FT                   transpeptidase; SMART: PASTA domain containing protein;
FT                   KEGG: azc:AZC_0337 penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34204"
FT                   /db_xref="GOA:C6WF72"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF72"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACU34204.1"
FT                   /translation="MRVRNSVLKLLGLCVLAGVLLAGALFPAVGALGVVSNQASDTVDS
FT                   ISSDLVTTDPPLITTITDRDGAPIAYLYDQYRVLVPPEDISPTMKAALVSVEDRRFYEH
FT                   QGVDWKGTTRAALTNQFSGSVTQGASTLTQQYVKNYLVHVVARNNKVEQQKAQEQTIAR
FT                   KMREARISLQLERKLGKEEILARYLNVVPFGSTIYGIAAASQAYFSTTADKLTVAQSAM
FT                   LAGMVNSPSALDPEVFPEKALERRNQVIDKMVENDKLSRDAAFEAKREPLGLAEPVRTP
FT                   PNGCVGAGPENGFFCSYVVEYLERNGFSIEQLKIGGYTVRTTLDRDITQKAKRAAEGQV
FT                   AKDTSGIANTMAVVRPGKESHEVVALVANRDYGLKADQFQTQFDLPSGVENKFGAGSIY
FT                   KVFTAAAALEKGMGIENVIPTPTFYESRVFKGGGNRCRSTGEPNTRWYCLGNDSATYSS
FT                   QMPLQQALQTSPNTGFVILEERLGMEPVVDMASRLGMRETMATNISGTPPDPRSKQREL
FT                   RVSQSEFYKQDGGNASFTLGPASASTLELANVAATIISGGTWCPPSPVAEVLDRDGQAV
FT                   PVNEAPCEQVVNEQLANGLAVGMSKDDQNGGTAAAAARGVKWTRPMLGKTGTTEEYKSA
FT                   AFIGATPDYAGAVQTYNDGPNPQPICVTGKPRLCANGNIYGGTVPARTWFDTMSQIHEG
FT                   LPVQQLPKVEPRYLKGGDEIRVPDVVGKSVNDATRVLQEAGYKVAQQSRNSAQAKGTVV
FT                   SQTPRGSALQGTLITLLVSTGYVPPPAPTQQPTQQPPTQGQPEQPTQPTQPGGQPGGGT
FT                   PGTPGQPGGPTRPTRPTR"
     gtgcgagtca ggaacagcgt gctgaaactg ctcggcctgt gcgtgctggc gggcgtcctg        60
     ctggcgggcg cgttgttccc cgccgtcggc gcgctgggcg tggtctcgaa ccaggcgagc       120
     gacaccgtcg acagcatctc ctcggacctg gtgacgaccg acccaccgct gatcacgacg       180
     atcacggacc gggacggcgc gccgatcgcg tacctgtacg accagtaccg ggtgctggtc       240
     cccccggagg acatctcccc cacgatgaag gcggccctcg tctcggtcga ggaccgccgg       300
     ttctacgagc accagggcgt ggactggaag ggcacgacgc gcgccgcgct gaccaaccag       360
     ttcagcggat cggtcaccca gggagcctcc acactcaccc agcagtacgt gaaaaattat       420
     cttgtccacg tcgtcgcacg gaacaacaag gtcgaacagc agaaggcgca agaacagacg       480
     atcgcgcgca aaatgcgcga ggcgcgcatc tcgttgcaac tggagcggaa actgggcaag       540
     gaggaaatcc tcgcccgcta cttgaacgtc gtcccgttcg gttcgacgat ctacggcatc       600
     gccgccgcct cgcaggccta cttcagcacc accgcggaca agttgaccgt cgcgcagtcc       660
     gcgatgctgg ccgggatggt caacagcccg tccgcgctcg atcccgaggt gttcccggag       720
     aaggcgctgg aacggcgcaa ccaggtgatc gacaagatgg tcgagaacga caagctctcg       780
     cgcgacgcgg ccttcgaggc caagcgcgag ccgctgggcc tggccgagcc ggtgcgcacc       840
     ccgcccaacg gctgcgtcgg cgccggtccg gagaacgggt tcttctgctc gtacgtcgtg       900
     gagtacctgg agcgcaacgg cttcagcatc gagcagctga agatcggcgg ctacacggtg       960
     cgcaccacgc tcgaccgcga catcacccag aaggccaagc gcgcggccga ggggcaggtc      1020
     gccaaggaca ccagcgggat cgccaacacg atggcggtcg tgcggccggg caaggagagc      1080
     cacgaggtcg tcgcgctggt cgcgaaccgc gactacgggc tcaaggccga ccagttccag      1140
     acccagttcg acctgccgag cggggtggag aacaagttcg gcgcggggtc gatctacaag      1200
     gtcttcaccg ccgccgccgc gctggagaag ggcatgggga tcgagaacgt catccccacc      1260
     ccgacgttct acgagtcgcg cgtgttcaag ggcggcggga accgctgccg cagcaccggc      1320
     gagccgaaca cccgctggta ctgcctcggc aacgactccg ccacgtactc ctcgcagatg      1380
     ccgctccagc aggcgttgca gacctcgccg aacaccgggt tcgtcatcct ggaggaacgg      1440
     ctcgggatgg agccggtggt ggacatggcc tcgcggctgg ggatgcgcga gacgatggcc      1500
     accaacatct ccggaacgcc gccggacccc aggtccaagc agcgcgagct gcgggtgtcg      1560
     cagagcgagt tctacaagca ggacggcggg aacgcctcgt tcacgctcgg cccggcgtcg      1620
     gcgagcacgc tggagctggc caacgtggcg gcgaccatca tcagcggcgg cacctggtgc      1680
     ccgccgtcgc cggtggccga ggtgctggac cgcgacgggc aggccgtccc ggtcaacgag      1740
     gccccgtgcg agcaggtggt caacgagcag ctcgccaacg ggctcgcggt gggcatgtcc      1800
     aaggacgacc agaacggggg cacggcggcc gcggcggcgc gcggcgtcaa gtggacccgg      1860
     ccgatgctgg gcaagaccgg cacgaccgag gagtacaagt cggcggcgtt catcggggcc      1920
     acgcccgact acgcgggcgc ggtgcagacc tacaacgacg gtcccaaccc gcagccgatc      1980
     tgcgtgaccg gcaagccgag gctgtgcgcg aacggcaaca tctacggcgg cacggtgccc      2040
     gcgcggacct ggttcgacac catgtcgcag atccacgagg gcctgccggt gcagcagctg      2100
     ccgaaggtgg agccgcgcta cctcaagggc ggcgacgaga tccgggtgcc cgacgtggtg      2160
     ggcaagagcg tcaacgacgc caccagggtg ctccaggagg ccgggtacaa ggtggcccag      2220
     cagagccgga actccgcgca ggccaagggg accgtggtga gccagacgcc gcgcggcagc      2280
     gccctgcagg gcacgctgat cacgctgctg gtgagcaccg gctacgtgcc gccgcccgcg      2340
     ccgacccagc agccgacgca gcagccgccc acccaggggc agccggagca gcccacccag      2400
     ccgacccagc ccggcggtca accgggcggg gggacaccgg gaacgccggg tcagccgggc      2460
     ggaccgacca ggccgaccag accgacccgc tga                                   2493
//

If you have problems or comments...

PBIL Back to PBIL home page