(data stored in ACNUC7421 zone)

EMBL: CP001630.PE231

CP001630.PE231       Location/Qualifiers
FT   CDS_pept        262504..262797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0236"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34205"
FT                   /db_xref="GOA:C6WF73"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF73"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ACU34205.1"
FT                   /translation="MQQQGDWRIKAACRDGEPDQLFVRGAEQRKVKVVCLGCPVRTECL
FT                   AEALDNRIEFGVWGGMTERERRALLKRRPDVTSWLELLDSARTDHYEESAAG"
     atgcagcagc agggggattg gcggatcaag gcggcgtgtc gtgatggaga gcccgatcag        60
     ctcttcgtcc ggggggccga acagcgcaag gtgaaggtcg tgtgcctggg ctgcccggtg       120
     cgcaccgagt gcctcgccga agcgctggac aaccggatcg agttcggcgt gtggggcggg       180
     atgaccgagc gcgagcgcag ggcgctgctg aagcggcgac cggacgtgac gtcgtggctc       240
     gaactgctcg actccgcgcg cacggaccac tacgaggagt cggcagcggg ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page