(data stored in ACNUC7421 zone)

EMBL: CP001630.PE232

CP001630.PE232       Location/Qualifiers
FT   CDS_pept        complement(262823..263947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0237"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   acp:A2cp1_0984 adventurous gliding motility protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34206"
FT                   /db_xref="GOA:C6WF74"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF74"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACU34206.1"
FT                   /translation="MNRLDVDALLDDPATRVLVCCGSGGVGKTTTAAALALRAAERGRR
FT                   AVVLTIDPARRLAQSLGLRELDNSPRPVVVEGFEPEGELHAMMLDMRRTFDDMVLAHAG
FT                   RERAQQILANPFYQTISTSFSGTQEYMAMEKLGQLVARDEWDLVVVDTPPSRSALDFLD
FT                   APQRLSTVLDGKLIKMLSAPARAGGRGIMKIVGTGFTLFTKAVSTIVGGQLLQDASTFV
FT                   QAFDSMFGGFRQRAQATYELLRSPGTEFLVVAAAEPDALREASYFVERLSAEEMPLAGL
FT                   VANRTHPVLAGLAPAGAEAAADRLEERVGGPSLASAVLRVHSDRVAVADREKRLLARFT
FT                   RAHPGVPLVGVPALPTDVHDLDGLREIGRRLAGE"
     gtgaacaggc tggacgtgga cgcgctgctg gacgacccgg cgaccagggt gctggtgtgc        60
     tgcgggtccg gcggcgtggg caagaccacc acggcggcgg cgctggcgct gcgggccgcc       120
     gagcgcggca ggcgcgcggt ggtgctcacc atcgacccgg cgcgcaggct ggcccagtcg       180
     ctggggttgc gcgagctgga caactcgccg aggccggtgg tcgtcgaggg cttcgagccc       240
     gagggcgagc tgcacgcgat gatgctggac atgcgccgca cgttcgacga catggtgctg       300
     gcgcacgcgg gccgggagcg ggcccagcag atcctggcca accccttcta ccagacgatc       360
     tccacctcgt tctccggcac gcaggagtac atggcgatgg agaagctggg ccagctcgtg       420
     gcgcgcgacg agtgggacct ggtggtggtg gacaccccgc cgagccggtc ggcgctggac       480
     ttcctggacg cgccgcagcg gctgtcgacg gtgctcgacg gcaagctgat caagatgctg       540
     tcggcgcccg cgcgcgcggg cggccggggc atcatgaaga tcgtcgggac cgggttcacc       600
     ctgttcacga aggccgtgtc gacgatcgtc ggcggccagc tgctccagga cgcgtccacg       660
     ttcgtgcaag cgttcgacag catgttcggc ggcttccggc agcgcgccca ggcgacctac       720
     gagctgctgc gctcaccggg gacggagttc ctggtggtcg cggcggccga accggacgcg       780
     ctgcgggagg ccagctactt cgtggagcgg ctctccgccg aggagatgcc gctggccggg       840
     ctggtggcga accggaccca cccggtgctg gccggtctgg ccccggcggg agccgaggcc       900
     gccgcggacc ggctggagga gcgggtgggc gggccgtcgc tggcctccgc cgtcctccgg       960
     gtgcactcgg accgggtcgc cgtcgcggac cgcgagaagc ggctgctggc gcggttcacc      1020
     cgtgcgcacc ccggtgttcc cctggtcggg gttcccgccc tgccaaccga cgtgcacgac      1080
     ctggacggtc tgcgcgagat cggccgccgg ctggcgggcg agtag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page