(data stored in ACNUC7421 zone)

EMBL: CP001630.PE233

CP001630.PE233       Location/Qualifiers
FT   CDS_pept        complement(263944..264936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0238"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   afw:Anae109_0972 chromosome partitioning-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34207"
FT                   /db_xref="GOA:C6WF75"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF75"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACU34207.1"
FT                   /translation="MTGWTDELSRARLHVVTGKGGTGKTTVAAALALALATGGRRVLLV
FT                   EVENRQGLAQLFDRPPLPYSEERIASAPGGGEVRALAVDPEAALLEYLAMFYNLGFAGR
FT                   TLRRMGAIEFATTLAPGLRDVLLTGKVKECVRRVGKSGRHEYDAVVLDAPPTGRVVRFL
FT                   DVTRAMADLAKVGPIKGQSEGVVALLHSGDTAVHLVSLLEEMPVRETLDAVAELDGADL
FT                   RPGAVFVNRARPHRLPPDAVLKAAEGGIDPAELREGFAEAGLVVPDEDLDGLAEQTADH
FT                   AQRVLAEARAKDKLAEADLPTLELPELTGGVDVAALYELAESLVERGVR"
     gtgaccggct ggaccgacga actctcccgc gcgcggctgc acgtcgtgac cggcaagggc        60
     gggaccggga agaccaccgt cgccgcggcg ctcgcgctgg cgctggcgac cgggggtcgc       120
     cgggtgctgc tcgtcgaggt ggagaaccgc cagggcctcg cccagctgtt cgaccgcccg       180
     ccgctgccct actccgagga gcggatcgcg tccgcgccgg gcggcgggga ggtgcgggcg       240
     ctcgcggtgg accccgaggc cgcgctgctg gagtacctgg ccatgttcta caacctgggc       300
     ttcgccgggc ggacgctgcg ccggatgggc gcgatcgagt tcgccaccac gctcgcgccg       360
     ggcctgcggg acgtgctgct caccggcaag gtcaaggagt gcgtgcgccg ggtcggcaag       420
     tccggccgcc acgagtacga cgccgtggtg ctggacgcgc cgccgaccgg ccgggtggtg       480
     cggttccttg acgtgacccg cgcgatggcc gacctggcga aggtcgggcc gatcaagggg       540
     cagagcgagg gcgtggtcgc gctgctgcac tccggcgaca ccgccgtgca cctggtgtcg       600
     ctgctggagg agatgccggt gcgcgagacg ctggacgcgg tggccgagct ggacggcgct       660
     gacctgcgac cgggcgcggt gttcgtgaac cgggcgcgcc cgcaccggct gcccccggac       720
     gcggtgctca aggccgccga gggcgggatc gacccggccg agctgcggga ggggttcgcg       780
     gaggccgggc tggtcgtgcc cgacgaggac ctggacgggc tggccgagca gaccgccgac       840
     cacgcgcagc gggtgctggc cgaggcgcgc gcgaaggaca agctcgcgga ggcggacctg       900
     ccgacgctgg agctgcccga gctgaccggg ggcgtggacg tggccgccct ctacgagctg       960
     gccgagtcgc tggtcgagcg gggggtgcgg tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page