(data stored in ACNUC7421 zone)

EMBL: CP001630.PE234

CP001630.PE234       Location/Qualifiers
FT   CDS_pept        complement(265300..265569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34208"
FT                   /db_xref="GOA:C6WF76"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34208.1"
FT                   /translation="METWRVVATGAFIVGGLVLVLVGMAQVRDRVRRRSERDAKHAQVL
FT                   RAALVGLVAVAAVALLIALWLPSTVAWALVAATALAIVFLTTAD"
     gtggagacct ggcgggtcgt ggccaccggc gccttcatcg tcggcgggct ggtgctggtg        60
     ctggtcggca tggcgcaggt gcgcgatcgc gtcagacggc gctcggagcg ggacgccaag       120
     cacgcgcagg tgctgcgcgc ggcgctggtc gggctggtcg cggtggcggc cgtcgcgctg       180
     ctgatcgcgc tctggctccc gtccacggtg gcctgggcgc tggtcgccgc gaccgcgctg       240
     gcgatcgtct tcctgaccac cgccgactga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page