(data stored in ACNUC7421 zone)

EMBL: CP001630.PE236

CP001630.PE236       Location/Qualifiers
FT   CDS_pept        266280..266738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0241"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rce:RC1_1921
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34210"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF78"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACU34210.1"
FT                   /translation="MTWTDRLAELGVELPEVAAPVAAYVPAVRTGSLVFTSGQLPFVGG
FT                   ALAATGKVGAEVSPEEAKAHARTCALNALAAVHALVGVDSVARVVKVVGFVASADGFTG
FT                   QPAVVNGASEFLGEVFGDAGAHARSAVGVAELPLGAPVEVELVVEIRE"
     gtgacctgga ccgaccgcct cgccgagctg ggcgtcgagc tgccggaggt ggccgccccg        60
     gtggccgcct acgtgcccgc cgtgcgcacc ggctcgctcg tgttcacctc cggccagctg       120
     ccgttcgtcg gcggcgccct cgccgccacc ggcaaggtcg gcgccgaggt gagccccgag       180
     gaggccaagg cccacgcccg gacctgcgcg ctcaacgcgc tcgccgccgt gcacgccctc       240
     gtcggcgtcg actcggtggc ccgcgtcgtc aaggtggtcg gcttcgtcgc ctccgccgac       300
     ggcttcaccg ggcagcccgc cgtcgtcaac ggcgcctccg agttcctcgg cgaggtcttc       360
     ggcgacgcgg gcgcgcacgc caggtccgcg gtcggggtgg ccgagctgcc gctgggcgcc       420
     cccgtcgagg tcgagctggt cgtcgagatc cgggagtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page