(data stored in ACNUC7421 zone)

EMBL: CP001630.PE237

CP001630.PE237       Location/Qualifiers
FT   CDS_pept        266740..267351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34211"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34211.1"
FT                   /translation="MSDTLHELLLRLSGRLPDDVMWRFRDWAATDAVSVLARTLPRTLL
FT                   HDRVGLTDHEQRLLESALVPHGADRAATSSIRALDELPETDFAFTPESPDRAAMGDSAT
FT                   VVLGATLRGRPGVGEVRSSWRQVGGRNGRTNRVILVTATSGCARLAGELQRVLRALGEH
FT                   DPCVEVLPAGLEPPPYHRAALASSELVCTGAEDEGHLVTV"
     atgtcggaca cgctgcacga gctgctgctg aggttgtcgg ggaggctccc cgacgacgtc        60
     atgtggcggt tccgggactg ggccgcgacc gacgccgtgt ccgtcctggc ccgcacgctg       120
     ccccgcaccc tgctgcacga ccgggtcggc ctgaccgacc acgagcagcg gctgctggag       180
     agcgccctgg tgccgcacgg cgcggaccgc gcggccacga gctccatccg ggccctggac       240
     gagctgcccg agaccgactt cgccttcacc ccggagtcgc ccgaccgggc ggcgatgggc       300
     gactcggcga cggtcgtgct cggcgcgacc ctgcgcggca ggccgggggt cggcgaggtc       360
     cgctcctcct ggcgccaggt cggcggcagg aacgggagga ccaaccgggt catcctggtc       420
     accgccacgt ccggctgcgc gcgcctcgcg ggcgagctgc agcgcgtgct gcgggcgctc       480
     ggcgagcacg acccctgcgt ggaggtcctg cccgccgggc tcgaaccgcc gccctaccac       540
     cgggcggcgt tggcgtcctc ggagctggtg tgcaccggcg ccgaggacga gggacacctg       600
     gtgaccgtct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page