(data stored in ACNUC7421 zone)

EMBL: CP001630.PE238

CP001630.PE238       Location/Qualifiers
FT   CDS_pept        267390..268634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34212"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34212.1"
FT                   /translation="MAQDGTGLPVRLHDLLLALAGRVDDDALAQAREMLAVSELDRAVD
FT                   HVVGCLIAGRIPVRAEEREELGALLGEVRSDPLLADRLLAVETLPHVRHRFTSESDPTK
FT                   DLADVLGRTASALPDVRSVRCTWRSSPAGATPGPLPQRVVLVDIGPKGFPTATAYRLDT
FT                   VLRKAGIRASVEVLIVGKPMNEYHAAASSSSREVYFPSAPLGAKGEAPDNAAWFDGEVR
FT                   DKAPVIEPEPVPADDNQNGSTKSRRGRDEAFEAIQPFPPKPVKRTAARDQAQKGEPAPP
FT                   AAPEQQTPPPPPPPPPVAPPPAPKAAPAPPPVVPVAPPVAPPPALPEDSPFSRAEVTME
FT                   LNPEDLAALQAALADGQAPASVNLPPTVDAKLSDRERALLQQLHEELAQREQQTWPGGA
FT                   EYVNGVPKPNNGKFS"
     gtggcgcaag acggaacggg actgcccgtc cgcctgcacg acctcctgtt ggcgctggcg        60
     ggccgcgttg acgacgacgc gctcgcccag gcgcgggaga tgctggcggt ctcggagctg       120
     gaccgcgcgg tcgaccacgt ggtcggctgc ctgatcgccg ggcgcatccc ggtcagggcc       180
     gaggagcgcg aggagctggg cgcgctgctg ggcgaggtcc gctcggaccc gctgctggcc       240
     gaccggttgc tggccgtgga gacgctgccg cacgtccggc accggttcac gtccgaatcg       300
     gacccgacga aggacctggc cgacgtgctc ggccggaccg cgtcggcgct gcccgacgtg       360
     cgctcggtgc gctgcacgtg gcgctccagc ccggcgggcg cgacaccggg gccgctgccg       420
     cagcgcgtgg tcctggtgga catcggcccc aagggcttcc cgaccgccac cgcgtaccgg       480
     ctcgacacgg tgctgcggaa ggcgggcatc cgggcctcgg tggaggtgct catcgtcggc       540
     aagccgatga acgagtacca cgccgcggcg tcgtcgtcct cgcgcgaggt ctacttcccc       600
     tcggcgccgc tcggcgccaa gggcgaggcg ccggacaacg ccgcctggtt cgacggcgag       660
     gtccgggaca aggcaccggt catcgagccg gaaccggtgc ctgccgacga caaccagaac       720
     ggctcgacca agtcccgacg tggccgcgac gaggcgttcg aggcgatcca gccgttcccc       780
     ccgaagccgg tcaagcgcac cgccgcgcgc gaccaggccc agaaggggga accggccccg       840
     cccgccgctc ccgagcagca gaccccgccg ccgcccccgc ctccaccgcc ggtggcgccc       900
     ccgcccgccc cgaaggcggc gcccgcgcca cctccggtgg tcccggtggc gcccccggtc       960
     gccccaccgc ccgccctgcc cgaggactcg ccgttctcgc gcgccgaggt gacgatggag      1020
     ctcaacccgg aggacctggc ggcgctccag gcggcgctgg ccgacgggca ggcgcccgcc      1080
     tcggtcaacc tgccgccgac cgtggacgcc aagctgagcg accgcgagcg ggccctgctc      1140
     cagcagctgc acgaggaact ggcccagcgg gagcagcaga cctggccggg tggggcggag      1200
     tacgtcaacg gcgtgcccaa gcccaacaac ggcaagttct cctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page