(data stored in ACNUC7421 zone)

EMBL: CP001630.PE239

CP001630.PE239       Location/Qualifiers
FT   CDS_pept        complement(268651..269457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34213"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF81"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3797"
FT                   /protein_id="ACU34213.1"
FT                   /translation="MSAVDGLARYAAGLACAARGAWREAEAHHAGALAAWGRDGRAAAV
FT                   DRGLVERARDGADACATAAEVAVELHRLVPAAHRRGAALLAASGARSPHVRVLADLASL
FT                   LARGPAPLGVVRALHRRTPGLAAALTDREWLVVGGSVRATPRCAEFLRAVNAAHAEAVE
FT                   RLWPDPPVVELVVEHPMAAARTGPSPQARLFDLLRALRYQRADAHHTAAHYTAAHHTAA
FT                   HQAAGAEHRSTSEDERVTDLAASAPYRRIDRARRAALVTDLRGLAD"
     gtgagcgcgg tggacgggtt ggcccggtac gcggcgggtc tggcctgcgc ggcgcggggc        60
     gcgtggcggg aggccgaggc gcaccacgcg ggcgcgctgg cggcgtgggg gcgggacggg       120
     cgggcggcgg cggtggaccg gggcctggtc gagcgggcgc gggacggggc ggacgcctgc       180
     gcgaccgccg ccgaggtcgc cgtcgagctg caccggctgg tgcccgccgc gcaccggcgc       240
     ggggcggcgc tgctggccgc gtcgggggcc cggtcgccgc acgtgcgggt gctggccgac       300
     ctggcgagcc tgctggcgcg cggtccggcg ccgctggggg tggtgcgcgc gctgcaccgc       360
     cgcacgccgg gcctggccgc cgcgctgacc gaccgggagt ggctggtggt gggtgggagc       420
     gtgcgggcga cgccgaggtg cgcggagttc ctgcgcgcgg tcaacgcggc gcacgccgag       480
     gcggtggagc ggttgtggcc ggacccgccg gtggtcgagc tggtggtgga gcacccgatg       540
     gccgccgcgc gcaccgggcc gtcgccgcag gccaggctgt tcgacctgct gagggcgctg       600
     cgctaccagc gcgcggacgc gcaccacaca gccgcgcact acacagccgc gcaccacaca       660
     gccgcgcacc aggcggcggg agcggagcac cgctcgacga gcgaggacga gcgggtgacg       720
     gacctggccg cgtcggcgcc ctaccggcgg atcgaccggg cgcgcagggc cgcgctggtg       780
     accgacctcc ggggcctggc tgactag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page