(data stored in ACNUC7421 zone)

EMBL: CP001630.PE24

CP001630.PE24        Location/Qualifiers
FT   CDS_pept        complement(26488..27951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0024"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: bcb:BCB4264_A4012
FT                   stage V sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33998"
FT                   /db_xref="GOA:C6WCH7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACU33998.1"
FT                   /translation="MGSPGTGAEDTPLARASGTSPGLKPPPTKRSTELFLLAFGAVLVT
FT                   AALVLVEANQEKELSLNIIWYGLAYLVMLAVTHLAVRTWAPYADPVILPCVTLLNGIGL
FT                   VMIHRIDLGMADVLVDGEPWSAAAPKQVMWTGLSLVLFCAALKLLKDHRTLAKFGYVSG
FT                   LVGLVALILPGVLPGFIAPTINGAKIWLRFGGVSIQPGEFAKILLMVFFAAFLVSKRDL
FT                   FTIAGRRFLGMDLPRARDLGPLIAVWAVVVSVMVLQKDLGSSLLFFGIVLVLLYVATER
FT                   AVWIIIGTVLFMGAAVAAWRMFTHVQTRVDNWVDPFADPGGAGYQIVQSLFGFGTGGLF
FT                   GAGLGGGRPDQIPEANTDFIAAVIGEELGLVGLTAVLLLYTVFALRGLRNALAVRDTFG
FT                   KLLGGGLAFAVAFQVFIIIGGVMKLIPMTGITAPFLSKGGSSLLANYVLVALLLRISDA
FT                   ARSPQAPVKPRVQQPAIADQFTVMVERPK"
     atgggttcgc cgggcaccgg cgcggaggac accccgctcg cgagggcgag cggcacgtcg        60
     ccggggttga aaccgccacc caccaagcgg agcaccgagc tcttcctcct ggccttcggc       120
     gcggtgctgg tcaccgccgc cctggtgctg gtcgaggcca accaggagaa ggagctctcg       180
     ctcaacatca tctggtacgg cctcgcctac ctggtgatgc tggccgtgac ccacctcgcg       240
     gtgcggacct gggcgcccta cgcggacccg gtgatcctgc cgtgcgtcac gctgctgaac       300
     gggatcggcc tggtgatgat ccaccggatc gacctgggca tggccgacgt gctcgtcgac       360
     ggtgagccct ggtccgccgc ggcaccgaag caggtcatgt ggacgggcct gtcgctggtg       420
     ctgttctgcg cggcgctcaa gctgctcaag gaccaccgca cgctggccaa gttcggctac       480
     gtctcgggcc tggtcggcct ggtcgcgctg atcctgcccg gcgtcctgcc cggcttcatc       540
     gccccgacga tcaacggcgc gaagatctgg ctgcgcttcg gcggcgtctc gatccagccg       600
     ggcgagttcg cgaagatcct gctgatggtc ttcttcgcgg ccttcctggt ctcgaagcgg       660
     gacctgttca ccatcgcggg ccgccggttc ctcggcatgg acctgccgcg cgcccgcgac       720
     ctcggcccgc tgatcgccgt gtgggcggtc gtcgtgtcgg tcatggtgct gcagaaggac       780
     ctcggctcgt cgctgctgtt cttcggcatc gtgctggtgc tgctgtacgt ggcgaccgag       840
     cgcgcggtgt ggatcatcat cggcaccgtc ctgttcatgg gcgccgcggt cgctgcctgg       900
     cggatgttca cgcacgtcca gacccgcgtg gacaactggg tcgacccgtt cgcggaccca       960
     gggggagccg gctaccagat cgtccagtcg ctgttcggct tcggcacggg cggcctgttc      1020
     ggcgccgggc tcggcggcgg acgccccgac cagatccccg aggcgaacac cgacttcatc      1080
     gccgccgtga tcggcgagga gctgggcctc gtcggcctca ccgccgtgct gctgctctac      1140
     acggtgttcg cgctgcgcgg cctgcgcaac gcgctggcgg tgcgcgacac gttcggcaag      1200
     ctgctcggcg gcggcctcgc gttcgcggtg gcgttccagg tcttcatcat catcggcggc      1260
     gtcatgaagc tgatcccgat gaccggcatc accgccccgt tcctgtccaa gggcggctcc      1320
     tcgctgctcg ccaactacgt cctggtagcg ctgctgctgc gcatctccga cgccgcgcgg      1380
     tccccgcagg cgccggtgaa gccgcgcgtg cagcagcccg cgatcgccga ccagttcact      1440
     gtcatggtgg agcgaccgaa atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page