(data stored in ACNUC7421 zone)

EMBL: CP001630.PE240

CP001630.PE240       Location/Qualifiers
FT   CDS_pept        complement(269454..270344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0245"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rec:RHECIAT_PC0000780 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34214"
FT                   /db_xref="GOA:C6WF82"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF82"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU34214.1"
FT                   /translation="MTVVAERLRVGLVGAGPWARAVHAPGLAAHPGVELVSVWGRRHDV
FT                   AAGLAAEHGAAAVREVDELLEQVDAVAFAVPPGVQAPIAVTAARRGRHLVLEKPVAESV
FT                   AGARELVDAVDEAGVAALVMLTRRFAPETREQLVDWRDLGGWTGGAARWVGGGLLGGPY
FT                   SASPWRHERGALDDVGPHAFDLLDAALGRITGVRAASCAGGLWQVLLEHESGAVSSAAL
FT                   GMSVPVSPGVAELEVFGAHGRRVLAGRGSTARDCYAVLLDDLVGAVASGAVRHPCDVRR
FT                   GLHLQRVIAEVRALA"
     gtgacggtgg tggctgaacg actgcgggtg gggctggtcg gcgcgggtcc gtgggcgcgg        60
     gcggtgcacg cgccggggct ggccgcgcac cccggcgtgg agctggtgtc ggtgtggggg       120
     cggcggcacg acgtggccgc cgggctcgcc gccgagcacg gcgcggcggc cgtgcgcgag       180
     gtggacgagc tgctggagca ggtggacgcg gtggcgttcg cggtgccgcc gggggtgcag       240
     gcgccgatcg cggtcacggc ggcccggagg ggcaggcacc tggtgctgga gaagccggtc       300
     gccgagtcgg tggcgggcgc gcgggagctg gtggacgcgg tcgacgaggc cggggtggcc       360
     gcgctggtga tgctgaccag gcggttcgcg ccggagacgc gggagcagct cgtggactgg       420
     cgggacctgg gcggctggac cggcggcgcg gcgcgctggg tcggcggcgg gctgctgggc       480
     gggccgtact cggcctcgcc gtggcggcac gagcggggcg cgctggacga cgtcgggccg       540
     cacgcgttcg acctgctgga cgcggcgctg ggccggatca ccggggtgcg ggcggcgagc       600
     tgcgcgggtg ggctgtggca ggtgctgctg gagcacgagt cgggtgcggt gagcagcgcg       660
     gcgctgggca tgtcggtgcc ggtgtcgccg ggcgtggccg agctggaggt gttcggcgcg       720
     cacggcaggc gggtgctggc ggggcgcggc tcgacggcgc gggactgcta cgcggtgctg       780
     ctggacgacc tggtcggcgc ggtggcgtcg ggcgcggtgc ggcacccgtg cgacgtgcgc       840
     agggggctgc acctgcagcg ggtgatcgcc gaggtgaggg cgctggcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page