(data stored in ACNUC7421 zone)

EMBL: CP001630.PE241

CP001630.PE241       Location/Qualifiers
FT   CDS_pept        complement(270356..270715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34215"
FT                   /db_xref="GOA:C6WF83"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34215.1"
FT                   /translation="MKGKGCLVNLAVLLAGAFGGVALTAVTGVLLFMPSTSVISSEPSD
FT                   GNRPGVYVKESTRFFGGTTHEVWLGCVERAHVVELPPGWEPNPAVEYTEAGLDLVFPDG
FT                   GRISVPEAKYAGDYC"
     atgaagggga aaggctgtct ggtcaacctc gccgtgctgc tcgcgggcgc cttcggcggg        60
     gtggcgctga ccgcggtgac gggcgtgctg ctgttcatgc cctccaccag cgtgatcagc       120
     agcgagccga gcgacgggaa ccggccgggg gtctacgtga aggagagcac ccggttcttc       180
     ggcggcacca cgcacgaggt gtggctgggc tgcgtggagc gggcgcacgt ggtcgagctt       240
     ccccccgggt gggagccgaa ccccgcggtc gagtacaccg aggccgggct cgacctggtc       300
     ttcccggacg ggggccggat ctcggtgccc gaggccaagt acgccgggga ctactgctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page