(data stored in ACNUC7421 zone)

EMBL: CP001630.PE242

CP001630.PE242       Location/Qualifiers
FT   CDS_pept        270739..271578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0247"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpd:RPD_3111 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34216"
FT                   /db_xref="GOA:C6WF84"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF84"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34216.1"
FT                   /translation="MSRGVIGRTLAVVRELPEELVLPPGALPATTPDPPAPTRDAASVL
FT                   LVRDGERGLEVFLQRRVLGMAFAGGMTVFPGGGVDPRDADTSVEWAGPPPSWWAGRFGC
FT                   GEEVARALVCAAVRETFEESGVLLAGPSASEVVADASAYFAERRALERRELSLAAFLAG
FT                   ARLVLRADLLRPWANWVTPVEEPRRYDTRFFTAALPDGQLADGVTSEASDAVWQRPSEA
FT                   IADWEEGRRLLLPPTWVALADLAELGSVAEALAVEREVDRVIPKLVRDGDVVRVVLP"
     gtgtcgcggg gcgtgatcgg ccgtacgctc gcggtcgtgc gagaactccc cgaggaactc        60
     gtcctgcccc ccggcgcgct ccccgcgacc acgccggacc cgcccgcccc caccagggac       120
     gcggcgtcgg tgctgctggt ccgcgacggc gagcgcgggc tggaggtgtt cctgcagcgc       180
     agggtgctcg gcatggcctt cgcgggcggc atgacggtgt tccccggcgg cggggtcgac       240
     ccgcgcgacg cggacacctc cgtggagtgg gccgggccgc cgccgtcgtg gtgggccggg       300
     cgcttcgggt gcggggagga ggtggcccgc gcgctggtgt gcgcggccgt gcgggagacc       360
     ttcgaggagt ccggggtgct gctggccggt ccgtcggcct cggaggtcgt cgcggacgcg       420
     agcgcgtact tcgccgagcg gcgggcgctg gagcgcaggg agctgtccct ggcggcgttc       480
     ctggccgggg cgcgcctggt gctgcgcgcc gacctgctgc ggccgtgggc gaactgggtg       540
     accccggtgg aggagccgcg ccgctacgac acccggttct tcaccgccgc cctgcccgat       600
     ggccagctgg cggacggggt gaccagcgag gcgtccgacg cggtgtggca gcggccgtcc       660
     gaggcgatcg ccgactggga ggagggccgc aggctcctgc tgccgcccac ctgggtggcg       720
     ctggcggacc tggccgagct ggggtcggtg gccgaggcgc tggccgtgga gcgggaggtg       780
     gaccgggtga tcccgaagct ggtgcgggac ggcgacgtgg tgcgggtggt gctgccgtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page