(data stored in ACNUC7421 zone)

EMBL: CP001630.PE243

CP001630.PE243       Location/Qualifiers
FT   CDS_pept        271575..272375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0248"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   aav:Aave_0793 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34217"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF85"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACU34217.1"
FT                   /translation="MSGRPAEGERFEHPAYGVLRPVTPEAAVLLADNPSVMTLDGTNTW
FT                   VLRAPGEESCVVVDPGPSDEAHLARAAGFGPVAQVLLTHGHPDHAEGAREFGERVGAPV
FT                   RALDPALRLGGEGLAHGDVVAAAGLEIRVVGTPGHTSDSLCFLVGGAVLTGDTILGRGT
FT                   TIVAHPDGRLGDYLESLRVLADLPPGTTVLPGHGPELPDAAEAARRYLAHREQRLAQVA
FT                   AALEALGPDATARQVVESVYADVDRALWPAAEWSVRAQLEHLRR"
     gtgagcgggc ggcccgccga gggggagcgg ttcgagcacc ccgcgtacgg ggtcctgcgg        60
     ccggtcacgc cggaggcggc ggtcctgctg gcggacaacc cgtccgtgat gaccctggac       120
     ggcacgaaca cgtgggtgct gcgcgcgccg ggcgaggagt cctgcgtcgt ggtcgacccc       180
     ggcccgagcg acgaggcgca cctggcgcgc gcggcgggct tcggcccggt ggcgcaggtg       240
     ctgctcacgc acggccaccc ggaccacgcg gagggcgcgc gcgagttcgg cgagcgcgtc       300
     ggcgccccgg tgcgggcgct ggacccggcg ctgcgcctgg gcggcgaggg cctggcgcac       360
     ggcgacgtcg tggcggcggc cggcctggag atccgggtgg tgggcacgcc gggccacacc       420
     tcggactcgc tgtgcttcct cgtcggcggc gccgtgctga ccggcgacac gatcctcggc       480
     cggggcacca ccatcgtggc tcacccggac gggcggctgg gggactacct ggagtcgctg       540
     cgcgtgctgg cggacctgcc gccgggcacc accgtgctcc ccggccacgg ccccgagctg       600
     cccgacgcgg cggaggcggc ccggcgctac ctggcgcacc gcgagcagcg cctggcccag       660
     gtcgcggcgg cgctggaggc cctcggcccg gacgcgacgg cgcggcaggt ggtggagtcg       720
     gtctacgcgg acgtggaccg cgccctgtgg cccgcggcgg agtggtcggt gcgcgcccag       780
     ctggagcacc tgcgccgctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page