(data stored in ACNUC7421 zone)

EMBL: CP001630.PE244

CP001630.PE244       Location/Qualifiers
FT   CDS_pept        272493..273131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr3017 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34218"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34218.1"
FT                   /translation="MTNKRALLTALTATTLALAGCTTLEPGRPVAAPGASAPASTSAKP
FT                   STSAKPSASGKPSASNAALTEIDVCGRVPADLMPTLVPQMVGKPGEATCAQEPTELNKA
FT                   GYPTQEGQFKVDGKVVMAIVVTVYQGALDMQGYVKFQLDQNPGKVSAYDVMSLPGYSGQ
FT                   SNFKDLKFVMGAAAGVNGDMHTGQVLLEQQPDELGMSATAFLLKMTIDD"
     atgacgaaca agcgcgcact gctcaccgcg ctcaccgcca cgacgctggc gctcgccggg        60
     tgcacgacgc tggaaccggg caggccggtg gccgcgccgg gcgcgagcgc ccccgcgagc       120
     acctcggcga agcccagcac ctccgccaag ccgagcgcgt ccggcaagcc cagcgcgtcg       180
     aacgccgcgc tcaccgagat cgacgtctgc ggccgggtgc ccgcggacct gatgccgacg       240
     ctggtgcccc aaatggtcgg caagccgggc gaggcgacct gcgcgcagga gccgaccgag       300
     ctcaacaagg ccggctaccc cacccaggag ggccagttca aggtcgacgg caaggtcgtc       360
     atggcgatcg tggtgaccgt ctaccagggc gccctggaca tgcagggcta cgtcaagttc       420
     cagctcgacc agaaccccgg caaggtgagc gcctatgacg tgatgagcct gccgggctac       480
     tcgggccagt cgaacttcaa ggacctgaag ttcgtcatgg gcgccgccgc gggcgtgaac       540
     ggcgacatgc acaccggcca ggtcctgctg gagcagcagc ccgacgagct ggggatgtcc       600
     gccaccgcgt tcctgctcaa gatgaccatc gacgactga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page