(data stored in ACNUC7421 zone)

EMBL: CP001630.PE245

CP001630.PE245       Location/Qualifiers
FT   CDS_pept        complement(273148..273483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34219"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34219.1"
FT                   /translation="MAASGTAVGGTAGKTVMRVLYSQHPGGAGEVAEVLKRLKPSGNIR
FT                   VEEAAIGKAGFRYRAPDTAAKFHVGGVTTIGSDALAVEIGTTDDLPDAAFAVPVLGLVV
FT                   TLGFLPG"
     atggcggcca gcggcacggc ggttggcggc acggcgggca agacggtcat gcgggtgctc        60
     tacagccaac accccggcgg cgcgggcgag gtggcggagg tgctgaagcg gctcaagccc       120
     agcgggaaca tccgggtgga ggaggcggcg atcggcaagg ccgggttccg gtaccgggcg       180
     ccggacaccg cggcgaagtt ccacgtcggt ggcgtgacca cgatcggctc ggacgcgctc       240
     gccgtcgaga tcggcaccac cgacgacctg cccgacgcgg cgttcgccgt gcccgtgctg       300
     gggctggtgg tcaccttggg gttcctgccc ggctag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page