(data stored in ACNUC7421 zone)

EMBL: CP001630.PE246

CP001630.PE246       Location/Qualifiers
FT   CDS_pept        complement(273605..274702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0251"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sus:Acid_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34220"
FT                   /db_xref="GOA:C6WF88"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF88"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU34220.1"
FT                   /translation="MDLTATTSELASAVADVARLLPGRVLDPVLAGVVLRAGPGGVELS
FT                   GSDRERSLRLSRAATTHSEGAALVPAKPLAETLRALESPQVRLVVEGSRLAVRTGAARF
FT                   ALPLLELGDHPGVPELPPVAGSAPAGAFASALAAVATAASKDDALPVFTGVRVHAAGDR
FT                   LELITSDRYRLGFASVPWAGGALDALAPAVQLAEVAKQAARDERVELRADADRLALAWG
FT                   GGSASTALLAAPFPDERARKLLAAEGECTVVLEADELAGAVRRAAPYSGAHGAVQLAAE
FT                   DGELRVRGSDPQAGESSESVKASVSGGLLTRSFQVRYLSDALRAFAGRRVELRVQSGLR
FT                   STVLTAEEDTSGVRLTYLVVPLRTP"
     atggacctca ccgccaccac ctcggaactg gcctccgccg tcgccgacgt cgcccgcctg        60
     ctgcccggcc gcgtgctcga ccccgtgctg gcgggcgtcg tgctgcgggc cgggccgggc       120
     ggggtggagc tgtcgggcag cgaccgggag cggtcgctgc ggctgagccg ggcggccacc       180
     acgcactccg agggggccgc gctggtgccc gcgaagccgc tggccgagac gctgcgggcg       240
     ctggagtccc cgcaggtgcg gctggtggtg gaggggtcgc ggctggccgt gcgcacgggg       300
     gcggcgcggt tcgcgctgcc gctgctggag ctgggggacc acccaggggt tccggagctg       360
     ccgccggtgg ccggttccgc gcccgccggg gcgttcgcct cggcgctggc ggcggtggcc       420
     acggcggcgt ccaaggacga cgcgctgccg gtgttcacgg gcgtgcgggt gcacgcggcc       480
     ggggaccggc tggagctgat cacctcggac cggtaccggc tggggttcgc gtcggtgccg       540
     tgggcgggcg gggcgctgga cgcgctggcc ccggccgtgc agctggccga ggtggcgaag       600
     caggccgcgc gggacgagcg ggtggagctg cgcgccgacg cggaccggtt ggccctggcc       660
     tggggcggcg ggagcgccag cacggcgctg ctggccgcgc cgttcccgga cgagcgggcg       720
     cggaagctgc tggccgccga gggcgagtgc acggtggtgc tggaggcgga cgagctggcc       780
     ggggcggtgc gccgggccgc gccgtactcg ggggcgcacg gggccgtgca gctggcggcc       840
     gaggacgggg agctgcgggt gcggggcagc gacccgcagg ccggggagtc gagcgagtcg       900
     gtgaaggcgt cggtcagcgg cgggctgctg accaggagct tccaggtccg gtacctgtcg       960
     gacgcgctgc gggcgttcgc ggggcggcgg gtggagctgc gggtgcagtc ggggctgcgg      1020
     tcgaccgtgc tgacggccga ggaggacacg agcggggtgc ggttgacgta cctcgtggtg      1080
     ccgctgcgga cgccctga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page