(data stored in ACNUC7421 zone)

EMBL: CP001630.PE247

CP001630.PE247       Location/Qualifiers
FT   CDS_pept        complement(274744..276042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0252"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sml:Smlt0548 putative MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34221"
FT                   /db_xref="GOA:C6WF89"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF89"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34221.1"
FT                   /translation="MVLAYQVCILARMSHSARLSDYRAALTTPAMRGPVVAGLFARLPI
FT                   AMIGFALLLYVQRASGSYGTAGLVSASALIGVALGAIAQGRLMDRFGPSRPLLAVTALF
FT                   ALAATGAVVAVESGVAVVVLAPLAFAVGFTEPMAGSASRALWTSIVPAGPLRDAGIAYE
FT                   AISMEVFFILGPGLAGVLVTAAWPGTGFVVGAAMMVVGALWFACTPTVRGRRPEPVQGG
FT                   GPLGALASPGMRTVALAALGFGLSIGFIEVAVPAAADAAGHKGVGGLLLSLWSVSSVLF
FT                   GVLYSLRPLPRPMHLRLPVLLGGFSLLAALLAIPTTLVGLAVALFVVGSLITPQSTAHS
FT                   AAIEQVAPEGTAAEAFGWVVTAVTLGLAAGQGLAGQIVEARGTSTAFLAAAASGLAVAV
FT                   VVWLLRGTVAAGAPGVPAGAAVPQEEEAGLVGR"
     ttggtactcg cgtaccaggt ctgcatactg gcacgcatgt cccactccgc ccggctctcc        60
     gactaccgcg ccgccctcac cacgcccgcg atgcgcggcc ccgtcgtcgc gggcctgttc       120
     gccaggctgc cgatcgcgat gatcggcttc gcgctgctgc tctacgtcca gcgggccagc       180
     ggctcctacg gcacggcggg gctggtgtcg gcctcggcgc tgatcggcgt cgcgctgggc       240
     gcgatcgcgc agggcaggct gatggaccgg ttcgggccga gcaggccgct gctggccgtc       300
     accgcgctgt tcgcgctggc cgcgaccggc gcggtcgtgg ccgtggagag cggcgtggcc       360
     gtggtggtgc tggcgccgct ggcgttcgcg gtcgggttca ccgagccgat ggccgggtcg       420
     gcgtcgcggg cgctgtggac gagcatcgtg cccgccgggc cgctgcgcga cgcgggcatc       480
     gcctacgagg cgatcagcat ggaggtcttc ttcatcctcg ggccggggct ggcgggcgtg       540
     ctggtcacgg cggcctggcc gggcaccggg ttcgtggtgg gcgcggcgat gatggtggtc       600
     ggcgcgctgt ggttcgcctg cacgccgacc gtgcgcgggc ggcggccgga gcccgtccag       660
     ggcggcggtc cgctcggcgc gctggcctcg ccggggatgc ggaccgtggc gctcgcggcg       720
     ctcgggttcg ggctgtcgat cgggttcatc gaggtggcgg tgcccgcggc ggccgacgcg       780
     gccgggcaca agggggtcgg cgggctgctg ctgagcctgt ggtcggtcag ctcggtgctg       840
     ttcggggtgc tgtactcgct gcgcccgctg ccgcgcccca tgcacctgcg gctgccggtg       900
     ctgctgggcg ggttctcgct gctcgcggcg ctgctggcga tcccgacgac gctcgtgggg       960
     ctcgcggtgg cgctgttcgt ggtcgggtcg ctgatcaccc cgcagtccac cgcgcactcg      1020
     gcggcgatcg agcaggtcgc gcccgagggc acagcggccg aggcgttcgg gtgggtggtc      1080
     acggcggtga cgctgggact ggcggccggg caggggctcg ccgggcagat cgtggaggcc      1140
     cgtgggacgt ccacggcgtt cctggcggct gccgcgtccg ggttggcggt cgcggtggtg      1200
     gtgtggttgc tgcgcgggac ggtcgcggcg ggcgcgcccg gcgttccggc gggcgccgct      1260
     gtcccccagg aggaggaagc ggggctcgtc gggcgctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page