(data stored in ACNUC7421 zone)

EMBL: CP001630.PE248

CP001630.PE248       Location/Qualifiers
FT   CDS_pept        complement(276747..277421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0253"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bbt:BBta_5745 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34222"
FT                   /db_xref="GOA:C6WF90"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF90"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACU34222.1"
FT                   /translation="MDETLARAGIFQGVEPAAAEALAQTLESVEFPRGHVIFAEGEPGD
FT                   RLYIIQSGKVKIGRKSPDGRENLLGIFGPSDMFGELSIFDPGPRTSTATTVTEVRAVSM
FT                   DRPALRQWISNRPEIAEQLLRALARRLRRTNSMLADLIFTDVPGRVAKALLQLAQRFGS
FT                   QEAGLLRVTHDLTQEEIAQFVGASRETVNKALADFAHRGWLRLEGKSVLILDPERLARR
FT                   AR"
     gtggacgaga ccctggcccg cgcgggcatc ttccaggggg ttgaaccggc ggcagcggag        60
     gcactggcgc agacgctgga gtccgttgaa ttcccgcgcg gccacgtgat cttcgcggag       120
     ggcgaaccgg gcgaccggct ttacatcatc caatccggaa aggtgaagat cgggcgcaag       180
     tcgccggacg gtcgggagaa cctgctcggg atcttcggac cgtcggacat gttcggcgag       240
     ctgtcgatct tcgaccccgg tccgcgcacg tccaccgcga cgacggtgac cgaggtgcgt       300
     gcggtcagca tggaccgccc ggcgctgcgg cagtggatct cgaaccggcc ggagatcgcg       360
     gagcagctgc tccgcgcgct ggcgcgcagg ctgcgccgga cgaactccat gctggccgac       420
     ctgatcttca cggacgtgcc cggccgcgtg gcgaaggcgc tgctccagct cgcccagcgg       480
     ttcggcagcc aggaggcggg gctgctgcgg gtgacgcacg acctgacgca ggaggagatc       540
     gcccagttcg tgggcgcctc gcgcgagacg gtcaacaagg ccctggcgga cttcgcccac       600
     cggggttggc tgcgcctgga gggcaagagc gtgctgatcc tggacccgga gcggctcgcg       660
     cgccgagccc ggtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page